VIP (Vasoactive Intestinal Peptide) Peptide

Vasoactive Intestinal Peptide (VIP) is an endogenous 28-amino acid neuropeptide with the sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂, molecular weight 3,326.83 g/mol, and CAS number 37221-79-7. First isolated from porcine duodenum by Said and Mutt in 1970, VIP is now recognized as one of the most widely distributed and functionally diverse neuropeptides in the human body.

VIP is expressed throughout the central and peripheral nervous systems, the gastrointestinal tract, the respiratory system, and immune tissues. It acts through two G protein-coupled receptors — VPAC1 (widely distributed) and VPAC2 (more restricted to CNS, pancreas, and immune cells) — both coupling to Gs and activating adenylyl cyclase/cAMP signaling.

In recent years, VIP has gained significant research attention for its potent anti-inflammatory properties, neuroprotective effects, and role in mold/biotoxin illness (Chronic Inflammatory Response Syndrome, CIRS). Dr. Ritchie Shoemaker's CIRS protocol uses VIP as a final-step treatment for persistent inflammation, bringing widespread awareness to this previously underappreciated neuropeptide.

VPAC1 Receptor (widely distributed): VIP binds VPAC1 with Kd ≈ 1 nM, activating Gs → adenylyl cyclase → cAMP → PKA. VPAC1 is expressed on immune cells (T-cells, macrophages, dendritic cells), neurons, epithelial cells, and vascular smooth muscle. Activation produces: vasodilation, bronchodilation, anti-inflammatory cytokine shift (IL-10 up, TNF-α/IL-6 down), and neuroprotection.

VPAC2 Receptor (restricted): Expressed primarily in the suprachiasmatic nucleus (SCN, circadian pacemaker), pancreatic beta cells, and specific immune cell subsets. VPAC2 activation regulates circadian gene expression (Per1, Per2), glucose-stimulated insulin secretion, and Th2 immune polarization.

Anti-Inflammatory Cascade: VIP is one of the most potent endogenous anti-inflammatory peptides known. It inhibits NF-κB activation in macrophages, shifts Th1→Th2 balance, promotes regulatory T-cell (Treg) differentiation, reduces costimulatory molecule expression on antigen-presenting cells, and inhibits NLRP3 inflammasome activation. This broad anti-inflammatory profile explains its efficacy in autoimmune and chronic inflammatory disease models.

Reconstitution procedure: Remove the lyophilized VIP vial from cold storage and allow it to equilibrate to room temperature for 15-20 minutes before opening to prevent condensation onto the peptide cake. Wipe the rubber septum with 70% isopropanol and allow to air-dry. Using a sterile syringe, draw the appropriate volume of bacteriostatic water (0.9% benzyl alcohol) or preservative-free sterile saline and inject slowly down the inner wall of the vial — never directly onto the peptide cake, which can cause localized denaturation through mechanical shear and rapid osmotic stress. VIP, despite its 28-residue length, typically enters solution within 3-5 minutes. Gently roll or invert the vial; do not vortex or shake vigorously, as foaming exposes the peptide to air-water interface stress that accelerates oxidation of Met17 and promotes aggregation.

Standard concentrations:

• 5 mg vial + 1.0 mL diluent = 5 mg/mL (5,000 mcg/mL)
• 5 mg vial + 2.5 mL diluent = 2 mg/mL (2,000 mcg/mL)
• 5 mg vial + 5.0 mL diluent = 1 mg/mL (1,000 mcg/mL)

Intranasal research preparations: For nasal delivery protocols used in chronic inflammatory response syndrome (CIRS) research models, VIP is typically formulated in preservative-free sterile saline at concentrations calibrated to deliver approximately 50 mcg per actuation in a 100 microliter spray volume. Compounding-grade preparation requires sterile technique, and the intranasal route is preferred in these investigational contexts because it partially bypasses extensive first-pass enzymatic degradation and provides direct access to olfactory and trigeminal pathways implicated in central peptide distribution.

Pharmacokinetic considerations: Native VIP has an exceptionally short plasma half-life of approximately 1-2 minutes due to rapid proteolysis by dipeptidyl peptidase-IV (DPP-IV), neprilysin (NEP/CD10), and other endopeptidases that cleave at the N-terminal His1-Ser2 and internal Lys-X bonds. This pharmacokinetic profile is the primary reason that systemic IV infusion has limited utility in research models and why intranasal, subcutaneous depot, and analog-stabilized approaches dominate the literature. Investigators studying receptor-level pharmacology in vitro should account for rapid degradation by including DPP-IV inhibitors (e.g., diprotin A, sitagliptin) in cell culture media when sustained receptor occupancy is required.

Oxidation control: Methionine 17 is the most labile residue. Practical measures to limit oxidation include: minimizing the time the reconstituted vial is exposed to room air, using amber or foil-wrapped storage containers, avoiding metal ion contamination (which catalyzes Met oxidation), and refraining from sonication. If solutions appear yellow or develop turbidity, they should be discarded.

Adsorption to surfaces: Like many amphipathic neuropeptides, VIP can adsorb to glass and polypropylene surfaces, particularly at low concentrations (<10 mcg/mL). For dilute working solutions, low-bind polypropylene tubes or addition of carrier protein (0.1% BSA) where compatible with downstream assays is recommended to maintain accurate effective concentrations.

Sterility and aseptic technique: All reconstitution and aliquoting steps should be performed in a laminar flow hood or with rigorous aseptic technique. Bacteriostatic water is appropriate for multi-use storage at 2-8°C up to 14 days; sterile water or saline aliquots intended for cell culture or sensitive in vivo work should be used within 24-48 hours of reconstitution.

Documentation: Record reconstitution date, diluent type, final concentration, and storage location on each vial to ensure experimental reproducibility and adherence to good research practice.

Lyophilized powder: When stored desiccated at -20°C in sealed, moisture-protected vials, lyophilized VIP retains chemical and conformational integrity for approximately 24 months. Short-term storage at 2-8°C is acceptable for up to 6 months provided the vial remains sealed and protected from humidity cycling. For extended archival storage exceeding 24 months, -80°C is preferred to minimize slow deamidation of asparagine and glutamine residues, which proceeds even in the solid state at higher temperatures.

Reconstituted solution: Following reconstitution in bacteriostatic water (0.9% benzyl alcohol) or preservative-free sterile saline, VIP solutions should be stored at 2-8°C and used within 14 days for maximal peptide integrity. Solutions must be protected from direct light at all times to limit photo-oxidation of the methionine residue at position 17 (Met17), a well-characterized vulnerability of VIP and PACAP-family peptides. Amber glass vials or foil-wrapped containers are recommended.

Aliquoting strategy: Because VIP is a 28-residue peptide containing multiple oxidation- and deamidation-prone residues (Met17, Asn9, Asn24, Gln16), repeated freeze-thaw cycles and repeated needle-puncture air exposure accelerate degradation. Investigators are encouraged to aliquot reconstituted material into single-use sterile cryovials immediately after reconstitution and flash-freeze at -80°C. Under these conditions, frozen aliquots remain analytically stable for several months when characterized by RP-HPLC and LC-MS. Avoid repeated freeze-thaw of any single aliquot; discard after first use.

Buffer and pH considerations: VIP exhibits optimal solution stability between pH 4.5 and pH 6.5. Strongly alkaline conditions promote both Met17 oxidation and Asp/Asn isomerization to iso-aspartate, which can substantially alter receptor binding to VPAC1 and VPAC2. For research applications requiring physiological pH, freshly prepared solutions in PBS or HEPES-buffered saline should be used within hours rather than days.

Visible signs of degradation: Cloudiness, particulate formation, yellow discoloration, or precipitate at the vial bottom indicate aggregation or hydrolytic breakdown — such material should not be used for quantitative research. Clear, colorless solutions are expected throughout the stability window.

Shipping and receipt: VIP is shipped lyophilized with cold packs. Upon receipt, transfer immediately to -20°C or -80°C storage. Brief exposure (24-48 h) to ambient temperatures during shipping does not appreciably degrade lyophilized material due to the absence of free water, but reconstitution should not occur until cold-chain storage has been re-established.

Analytical QC recommendations: Laboratories conducting long-term studies are advised to re-verify peptide purity by analytical RP-HPLC and MALDI-TOF or ESI-MS at intervals, particularly before pivotal experiments. Documented Met17 sulfoxide formation (+16 Da mass shift) is the most common indicator of oxidative degradation and can be partially mitigated by including trace antioxidants such as 0.01% methionine or ascorbate in storage buffers, though such additives must be controlled for in downstream assays.

Note: VIP is inherently more degradation-prone than smaller peptides due to its length (28 residues), methionine content, and multiple amide side chains. Disciplined cold-chain handling, light protection, and single-use aliquoting are the single most important determinants of reproducible experimental outcomes.