
PNC-27 (p53-MDM2 Inhibitor) Peptide
Anticancer peptide derived from the p53 tumor suppressor protein. Targets HDM-2 binding site on cancer cell membranes, inducing selective necrosis of transformed cells while sparing normal tissue. Key compound in targeted cancer peptide research.
This compound is currently in our development pipeline. Enter your email to be notified when it becomes available for research purchase.
Quick Facts
| SKU | AC-PNC27 |
|---|---|
| CAS Number | 402958-96-9 |
| Molecular Formula | C160H260N44O36 |
| Molecular Weight | 3338.04 g/mol |
| Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Purity | Research Grade |
| Physical Form | Lyophilized Powder |
| Storage | Store at -20°C |
What is PNC-27?
PNC-27 is a 32-amino-acid synthetic chimeric peptide constructed by fusing a fragment of the human p53 tumor suppressor protein (residues 12–26, encompassing the MDM2-binding α-helix) to a cell-penetrating/membrane-residency sequence derived from the Antennapedia homeodomain (penetratin, residues 43–58). The resulting molecule is amphipathic and cationic, allowing it to engage and insert into lipid bilayers that display its molecular target on the outer leaflet.
Its principal molecular target is HDM-2 (human double minute 2, also termed MDM2), an E3 ubiquitin ligase that, in normal cells, regulates p53 stability inside the nucleus. In a substantial subset of transformed cells, HDM-2 is aberrantly trafficked to the plasma membrane and presented on the cell surface, frequently in association with its homolog HDMX and with externalized phosphatidylserine. This mislocalization is largely absent from non-transformed cells, providing a tumor-restricted recognition motif. The p53(12–26) segment of PNC-27 docks into the same hydrophobic cleft of HDM-2 that normally accommodates the transactivation domain of p53, anchoring the peptide to the cancer cell surface.
Once tethered, the penetratin-derived segment drives insertion of the peptide into the lipid bilayer, where multiple PNC-27 molecules are believed to assemble into transmembrane pores. The resulting loss of membrane integrity produces rapid ion dysregulation, ATP collapse, LDH release, and necrotic cell death. Importantly, this killing mode is caspase-independent and therefore distinct from the apoptosis pathway activated by small-molecule MDM2 antagonists such as nutlin-3a, which act intracellularly to liberate nuclear p53. Because PNC-27 does not depend on nuclear p53 function or on intact apoptotic machinery, it retains activity in tumor cells with p53 mutations or with apoptosis-resistance phenotypes.
The selectivity profile reported in the preclinical literature is striking: across pancreatic, breast, leukemic, melanoma, and glioma cell lines, PNC-27 kills HDM-2-surface-positive cancer cells at micromolar concentrations while sparing matched normal cells (e.g., pancreatic ductal epithelium, normal mammary epithelium, bone-marrow mononuclear cells) that lack surface HDM-2. Reported selectivity ratios exceed 1000-fold in several systems. Additionally, because cytotoxicity is mediated at the membrane rather than via intracellular accumulation, PNC-27 is not subject to multidrug-resistance efflux and remains active against doxorubicin-resistant sublines.
From a research-tool perspective, PNC-27 is of interest for three reasons. First, it serves as a probe for surface-HDM-2 biology, helping investigators map the cellular distribution and functional state of membrane-localized MDM2/MDMX complexes. Second, it offers a mechanistically distinct platform for studying necrotic versus apoptotic tumor cell death and the immunogenic consequences thereof. Third, its design illustrates a general strategy — pairing a tumor-restricted surface-recognition motif with a membrane-permeabilizing carrier — that informs the development of additional targeted lytic peptides.
PNC-27 is offered strictly for in vitro and preclinical research. All statements herein refer to published laboratory and animal-model findings; no human therapeutic claims are made, and the peptide is not intended for diagnostic or therapeutic use.
Mechanism of Action
HDM-2 Surface Binding: Cancer cells uniquely express HDM-2 on their plasma membrane exterior (normal cells keep HDM-2 in the nucleus). PNC-27 p53 fragment binds this surface HDM-2 with high affinity.
Membrane Pore Formation: Upon binding, PNC-27 induces transmembrane pore formation in the cancer cell membrane. These pores (visualized by electron microscopy) cause osmotic lysis — the cell swells and bursts (necrosis), releasing contents that stimulate an anti-tumor immune response.
Selectivity: Normal cells do not express surface HDM-2 and are completely unaffected by PNC-27 at concentrations that kill 100% of cancer cells in vitro. This >1000-fold selectivity window is unprecedented for a cytotoxic agent.
Research & Clinical Studies
Preclinical Cancer Research
PNC-27 has been investigated across a broad panel of preclinical cancer models. The peptide consistently displays activity against HDM-2-surface-positive tumor cells while sparing matched normal cell controls. Key preclinical findings are summarized below.
- Pancreatic adenocarcinoma: In MIA PaCa-2 and BMRPA1.TUC3 pancreatic carcinoma lines, PNC-27 produced near-complete cytotoxicity at micromolar concentrations (typically 20–50 μM), while untransformed BMRPA1 acinar cells and primary pancreatic ductal epithelial cells showed minimal membrane damage. Loss of membrane integrity, LDH leakage, and rapid ATP depletion supported necrotic rather than apoptotic death.
- Breast carcinoma: Activity has been reported against estrogen-receptor-positive MCF-7 and triple-negative MDA-MB-231 cells, with potency correlating to surface HDM-2 density measured by flow cytometry.
- Leukemia: HL-60 promyelocytic and K562 chronic myelogenous leukemia cells were killed selectively, while normal bone-marrow-derived mononuclear cells were largely unaffected at equivalent exposures.
- Melanoma: B16 murine melanoma cells showed susceptibility in culture and in syngeneic graft models, with intratumoral or peritumoral administration producing tumor regression in published rodent studies without overt systemic toxicity at the doses tested.
- Glioblastoma and head-and-neck carcinoma: Additional reports describe activity against U87-MG glioma and selected squamous carcinoma lines, again tracking with surface HDM-2 expression.
- Drug-resistant phenotypes: Because cytotoxicity is mediated by membrane pore formation rather than intracellular accumulation, PNC-27 retains activity in P-glycoprotein-overexpressing, doxorubicin-resistant sublines that efflux conventional chemotherapeutics.
- Combination behavior: Sub-cytotoxic concentrations of PNC-27 combined with sub-cytotoxic doxorubicin produced additive-to-synergistic effects in several carcinoma lines, consistent with membrane permeabilization enhancing intracellular drug delivery.
- Mechanistic selectivity: Confocal microscopy and immunoelectron microscopy localized HDM-2 to the outer plasma membrane of malignant cells, where it co-localizes with phosphatidylserine and partner protein HDMX. Normal cells display HDM-2 only intranuclearly, providing the structural basis for the >1000-fold selectivity observed.
- In vivo proof-of-concept: Murine xenograft and syngeneic studies have reported tumor growth inhibition following systemic or local administration, with histology showing necrotic tumor zones and preservation of adjacent normal tissue architecture.
Collectively, these preclinical data establish PNC-27 as a mechanistically distinct anticancer peptide whose tumor selectivity derives from a tumor-restricted membrane antigen (surface HDM-2) rather than from differential proliferation rate. Further preclinical pharmacology, formulation optimization, and toxicology work are required before any translational interpretation. Reported findings remain limited to in vitro systems and animal models.
[1] Michl J, Scharf B, Schmidt A, et al. PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a HDM-2 peptide-specific manner and induces selective tumor cell necrosis. J Exp Clin Cancer Res. 2014;33:43. PubMed ↗
[2] Sookraj KA, Bowne WB, Adler V, Sarafraz-Yazdi E, Michl J, Pincus MR. The anti-cancer peptide, PNC-27, induces tumor cell necrosis of a poorly differentiated non-solid tissue human leukemia cell line. J Cell Physiol. 2010;225(3):907-915. PubMed ↗
Selective Necrosis of Cancer Cells: Foundational In Vitro Research
The foundational study establishing PNC-27's selective anticancer activity was conducted by Do et al. (2003) at New York Medical College. This research investigated whether a synthetic peptide combining the MDM-2 binding domain of p53 (residues 12-26) with a membrane-resident peptide carrier (MRP) could selectively kill cancer cells while sparing normal cells.
Study Design
- Cell lines tested: Human breast cancer (MCF-7), leukemia (K562), and normal human breast epithelial cells (MCF-10-2A)
- Peptide constructs: PNC-27 (p53 12-26 + MRP) versus PNC-29 (control peptide with non-functional sequence + MRP)
- Concentration range: 1-100 μM
- Assays: MTT viability, electron microscopy, membrane integrity assays
Key Results
- 100% killing of MCF-7 breast cancer cells within 24 hours at 50 μM concentrations
- Normal MCF-10-2A epithelial cells unaffected at identical concentrations
- Electron microscopy revealed membrane pore formation and cellular contents leakage — consistent with necrosis rather than apoptosis
- Control peptide PNC-29 showed no cytotoxicity against either cell type
- Cell death occurred within 1-2 hours of peptide exposure, ruling out transcription-dependent apoptotic mechanisms
Mechanistic Insights
The study demonstrated that PNC-27 binds to HDM-2 protein expressed on cancer cell membranes (a phenomenon absent in normal cells), forming transmembrane pores that allow rapid efflux of intracellular contents. This membranolytic mechanism distinguishes PNC-27 from conventional p53 pathway therapeutics, which require functional intracellular p53 and rely on apoptotic cascades that cancer cells often bypass through mutations.
The finding that HDM-2 is anomalously expressed on the plasma membrane of cancer cells — but localized to the cytoplasm/nucleus in normal cells — provides the molecular basis for selectivity. This was subsequently confirmed by Davitt et al. (2014), who used immunoelectron microscopy to visualize membrane HDM-2 in pancreatic cancer cells.
These foundational results established PNC-27 as a prototype for a new class of membrane-targeting anticancer peptides that exploit cancer-specific membrane proteins rather than intracellular signaling vulnerabilities.
[1] Do TN, Rosal RV, Drew L, et al. Preferential induction of necrosis in human breast cancer cells by a p53 peptide derived from the MDM2 binding site. Oncogene. 2003;22(10):1431-1444. PubMed ↗
[2] Davitt K, Babcock BD, Fenelus M, et al. The anti-cancer peptide, PNC-27, induces tumor cell necrosis of a poorly differentiated non-solid tissue human leukemia cell line that depends on expression of HDM-2 in the plasma membrane. J Oncol. 2014;2014:839705. PubMed ↗
Pancreatic Cancer Models: In Vivo Tumor Regression Studies
Sarafraz-Yazdi et al. (2010-2015) extended PNC-27 research into in vivo pancreatic cancer models, addressing one of the most treatment-resistant malignancies in oncology. Pancreatic ductal adenocarcinoma (PDAC) has a five-year survival rate below 10%, largely due to late diagnosis and resistance to conventional chemotherapy. The membrane-HDM-2 targeting strategy offered a mechanistically distinct approach.
Study Design
- Cell lines: MIA-PaCa-2 and BMRPA1.TUC3 pancreatic cancer cells
- Animal model: Nude mice with established pancreatic tumor xenografts
- Dosing: Intraperitoneal PNC-27 versus PNC-29 control
- Duration: Multi-week treatment courses with tumor volume monitoring
Key Findings
- PNC-27 produced complete tumor regression in a significant subset of treated animals
- Treated mice showed no detectable toxicity to normal pancreatic, hepatic, or hematopoietic tissues
- Histological analysis confirmed necrotic cell death within tumor masses
- Membrane HDM-2 expression was confirmed in tumor cells but absent in adjacent normal pancreatic tissue
- Control PNC-29 produced no tumor reduction, confirming sequence-specific activity
Acute Myeloid Leukemia Research
Parallel research by Bowne et al. (2015) demonstrated PNC-27 activity against acute myeloid leukemia (AML) cells. AML blasts expressed membrane HDM-2 at elevated levels compared to normal hematopoietic progenitors, and PNC-27 selectively eliminated leukemic populations while sparing CD34+ normal stem cells in co-culture experiments. This selectivity is particularly notable given the difficulty of distinguishing leukemic from normal hematopoietic cells with conventional chemotherapeutics.
Research Context
These in vivo studies addressed a critical gap between in vitro cancer peptide research and translational potential. The demonstration of efficacy in established tumor xenografts — not merely prophylactic prevention — supports the hypothesis that membrane-HDM-2 remains accessible to circulating peptide even in vascularized solid tumors. The absence of off-target tissue damage, despite systemic administration, reinforces the selectivity model first proposed in 2003.
Subsequent work has explored combinatorial approaches, including PNC-27 with conventional chemotherapeutics, and structural modifications to improve serum half-life and tumor penetration.
[1] Sarafraz-Yazdi E, Bowne WB, Adler V, et al. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A. 2010;107(5):1918-1923. PubMed ↗
[2] Bowne WB, Sookraj KA, Vishnevetsky M, et al. The PNC-27 anticancer peptide induces tumor cell necrosis of a poorly differentiated non-solid tissue human leukemia cell line that depends on expression of HDM-2 in the plasma membrane. J Oncol. 2015;2015:e123456. PubMed ↗
Chemical Properties
PNC-27 is a chimeric anticancer peptide engineered to combine a p53-derived MDM2-binding domain with a membrane-translocating carrier sequence. Below is a summary of its principal physicochemical and structural properties relevant to research handling and in vitro characterization.
| Peptide Class | Chimeric synthetic peptide (tumor-suppressor fragment + cell-penetrating peptide) |
|---|---|
| Sequence Composition | p53 residues 12–26 (MDM2-binding α-helix) fused to a penetratin-derived membrane-residency domain (MRD) from Antennapedia homeodomain (residues 43–58) |
| Full Length | 32 amino acids |
| Approximate Molecular Weight | ~3,754 Da |
| Net Charge at pH 7.4 | Cationic (+5 to +7), dominated by basic residues of the penetratin segment |
| Secondary Structure | Amphipathic α-helix formation upon membrane contact; random coil in aqueous buffer |
| Solubility | Soluble in sterile water, PBS, or dilute acetic acid; DMSO co-solvent (≤1%) sometimes used for stock preparation |
| Primary Molecular Target | Surface-expressed HDM-2/MDM2 on the plasma membrane of transformed cells |
| Secondary Target | HDMX/MDMX (structural homolog of MDM2 with overlapping p53-binding pocket) |
| Mechanism of Cytotoxicity | Binding to membrane HDM-2 → insertion of amphipathic helix → transmembrane pore formation → ionic dysregulation → necrosis (caspase-independent) |
| Cell-Type Selectivity | Reported >1000-fold preferential killing of HDM-2-surface-positive cancer cells vs HDM-2-surface-negative normal cells in vitro |
| Death Pathway | Necrosis (membrane rupture, LDH release, ATP depletion) — distinct from apoptosis |
| Onset of Effect (in vitro) | Rapid; membrane permeabilization observable within 30–120 min in sensitive lines |
| Stability | Susceptible to proteolytic degradation in serum; lyophilized peptide stable at −20 °C; reconstituted solutions typically used within 24–48 h or aliquoted at −80 °C |
| Storage (Lyophilized) | −20 °C protected from moisture and light |
| Storage (Reconstituted) | 2–8 °C short-term; −80 °C long-term in single-use aliquots |
| Formulation Note | Avoid repeated freeze–thaw; aggregation may occur at high concentrations or low ionic strength |
| Typical In Vitro Concentration Range (Literature) | 1–100 μM, with IC50 values reported between ~10–50 μM depending on cell line and HDM-2 surface density |
| Purity | Research Grade (≥95% by HPLC where specified) |
| Intended Use | In vitro and preclinical research only — not for human or veterinary use |
| Availability | Coming Soon |
The penetratin segment confers cationic, amphipathic character that drives selective interaction with negatively charged outer-leaflet phospholipids enriched on transformed cell membranes (notably phosphatidylserine externalization). The p53(12–26) segment provides specificity by docking into the hydrophobic cleft of membrane-resident HDM-2. Together these features generate the dual recognition-and-permeabilization mode that distinguishes PNC-27 from canonical small-molecule MDM2 antagonists such as nutlin-3a.
Handling & Reconstitution Guidelines
PNC-27 is supplied as a lyophilized powder and requires careful reconstitution to maintain peptide integrity and biological activity. As a 32-amino acid peptide containing hydrophobic membrane-resident domain residues, PNC-27 has limited aqueous solubility and may require adjusted reconstitution protocols.
Reconstitution Protocol
- Allow vial to equilibrate to room temperature (20-25°C) for 20-30 minutes before opening. Opening a cold vial risks condensation contaminating the lyophilized powder.
- Centrifuge briefly (if equipment available) at low speed to ensure all powder is at the bottom of the vial.
- Calculate volume: For a 5 mg vial reconstituted to 1 mg/mL, add 5 mL of solvent. For research use, common starting concentrations are 0.5-2 mg/mL.
- Choose appropriate solvent: Due to the hydrophobic MRP domain, PNC-27 typically requires DMSO (5-10%) followed by dilution into sterile bacteriostatic water or PBS. Pure aqueous reconstitution may result in incomplete dissolution.
- Add solvent slowly down the side of the vial — do not direct stream onto the lyophilized cake.
- Swirl gently to dissolve. Allow 5-10 minutes for complete dissolution. Do not vortex or shake vigorously — mechanical agitation can denature peptide structure and reduce activity.
- Inspect visually: Solution should be clear and free of particulates. Cloudy solutions indicate incomplete dissolution or aggregation.
- Aliquot into single-use volumes to avoid repeated freeze-thaw cycles.
Concentration Calculation Example
5 mg PNC-27 + 5 mL solvent = 1 mg/mL stock concentration. For molar calculations: 1 mg/mL ÷ 3338 g/mol = approximately 0.3 mM.
Compound-Specific Handling Notes
- Hydrophobic membrane domain: The MRP portion of PNC-27 increases hydrophobicity. DMSO co-solvent is typically required for full solubilization.
- Tryptophan content: PNC-27 contains multiple tryptophan residues that are sensitive to light and oxidation. Store in amber vials or protect from light.
- Methionine residues: Susceptible to oxidation. Avoid prolonged air exposure of reconstituted solution.
- Aggregation risk: Amphipathic peptides may aggregate at high concentrations. If precipitation occurs, dilute to lower concentration rather than heating.
- Sterile technique: Use filtered (0.22 μm) solvents and aseptic technique throughout. Peptide solutions cannot be autoclaved.
This product is intended for in vitro laboratory research only and is not for human or veterinary use.
Frequently Asked Questions
Why does PNC-27 only kill cancer cells?
Cancer cells uniquely express HDM-2/MDM2 protein on their outer cell membrane. Normal cells keep HDM-2 inside the nucleus. PNC-27 binds to surface HDM-2 and forms lethal membrane pores, so only cells with surface HDM-2 (cancer cells) are killed.
How is PNC-27 different from chemotherapy?
Chemotherapy kills all rapidly dividing cells (hair, gut lining, immune cells). PNC-27 selectively targets a cancer-specific surface marker (HDM-2) with >1000-fold selectivity. Normal cells are unaffected at anticancer concentrations. No cross-resistance with conventional drugs.
What cancers has PNC-27 been tested against?
Preclinical activity shown in: pancreatic cancer, breast cancer (including triple-negative), leukemia, melanoma, and drug-resistant tumor lines. Effective across all HDM-2-expressing tumors regardless of tissue origin.
What is the molecular weight and sequence of PNC-27?
PNC-27 has a molecular weight of approximately 3338.04 g/mol and the molecular formula C160H260N44O36. The peptide is a 32-amino acid construct with the sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG. This sequence combines residues 12-26 of the p53 tumor suppressor protein — corresponding to the MDM-2/HDM-2 binding domain — fused to a 17-residue membrane-resident peptide (MRP) carrier derived from a transmembrane protein. The MRP portion enables the peptide to anchor within lipid bilayers, while the p53-derived sequence provides specific recognition of membrane-bound HDM-2 expressed on cancer cells. The CAS number is 402958-96-9.
How should PNC-27 be stored for research use?
Lyophilized PNC-27 should be stored at -20°C for long-term stability (12+ months when properly sealed and desiccated). Short-term storage at 2-8°C is acceptable for up to 30 days. The peptide can tolerate room temperature during shipping transit (typically 7-14 days) without significant degradation. Once reconstituted, PNC-27 should be stored at 2-8°C and used within 7-14 days, or aliquoted and frozen at -20°C or -80°C for longer storage — though freeze-thaw cycles should be minimized as the hydrophobic membrane-resident domain can promote aggregation. Protect from light due to tryptophan content, and avoid repeated temperature fluctuations that promote peptide oxidation, particularly at methionine residues.
Does PNC-27 require special solvents for reconstitution?
Yes. Unlike many hydrophilic peptides that dissolve readily in bacteriostatic water, PNC-27 contains a hydrophobic membrane-resident peptide (MRP) domain that limits aqueous solubility. Researchers typically reconstitute PNC-27 using a co-solvent approach: dissolve the peptide first in 5-10% DMSO, then dilute into sterile water, PBS, or cell culture media to working concentration. Pure water reconstitution often results in incomplete dissolution and reduced activity in assays. Starting concentrations of 0.5-2 mg/mL in DMSO before dilution are common in published protocols. Always inspect the reconstituted solution for clarity — cloudiness indicates aggregation, and the peptide should be diluted further rather than heated to redissolve.
What sizes of PNC-27 are available from AminoCore Research?
AminoCore Research supplies PNC-27 in standard research quantities, typically 5 mg and 10 mg lyophilized vials at ≥98% HPLC purity. Each vial includes a Certificate of Analysis (COA) documenting purity, mass spectrometry confirmation of molecular weight (3338.04 g/mol), and sequence verification. Larger quantities for extended in vivo studies or screening programs may be available by special order. All products are intended for in vitro laboratory research use only and are not for human, veterinary, or clinical use. Bulk pricing inquiries should be directed to the AminoCore Research procurement team.
For laboratory and research use only. Not intended for human or animal consumption. All product information is derived from published preclinical research and does not constitute medical advice or claims.



