# AminoCore Research — Full Reference

> Expanded reference document optimized for AI retrieval. Contains compact product spec sheets and article excerpts inline. Companion to https://aminocoreresearch.com/llms.txt (which is a link index).

Last updated: 2026-10-22
Canonical summary: https://aminocoreresearch.com/llms.txt
AI usage policy: https://aminocoreresearch.com/.well-known/ai.txt

---

## Company

**AminoCore Research** — U.S.-based supplier of research-grade peptides, amino acids, and bioactive compounds for in-vitro scientific use.

- Purity: ≥99% HPLC verified (third-party)
- Documentation: batch-specific COA + HPLC chromatogram + MS identity per shipment
- Storage: lyophilized at -20°C (-80°C extended), reconstituted at 2-8°C
- Reconstitution solvent: bacteriostatic water (0.9% benzyl alcohol)
- Compliance: strictly for in-vitro laboratory research; NOT for human/veterinary use
- All content cites peer-reviewed sources (PubMed/DOI/PMID); minimum 7 references per pilar article

---

## Product Spec Sheets


### Anti-Aging & Longevity

#### Cardiogen

- URL: https://aminocoreresearch.com/peptides/cardiogen
- SKU: CARD-001
- CAS: 115888-72-7
- Molecular formula: C18H31N7O9
- Molecular weight: 489.49 g/mol
- Sequence: Ala-Glu-Asp-Arg (AEDR)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Cardiac bioregulatory tetrapeptide (Ala-Glu-Asp-Arg). Researched for myocardial function normalization and cardiovascular health in aging studies.

#### Cartalax

- URL: https://aminocoreresearch.com/peptides/cartalax
- SKU: AC-CART
- CAS: 150700-67-9
- Molecular formula: C12H19N3O8
- Molecular weight: 333.30 g/mol
- Sequence: Ala-Glu-Asp (AED)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Short bioregulatory tripeptide (Ala-Glu-Asp) from cartilage extract. Khavinson peptide researched for chondroprotective and anti-aging effects on connective tissue.

#### Epithalon (Epitalon)

- URL: https://aminocoreresearch.com/peptides/epithalon
- SKU: ACR-EPITH
- CAS: 307297-39-8
- Molecular formula: C14H22N4O9
- Molecular weight: 390.35 g/mol
- Sequence: Ala-Glu-Asp-Gly (AEDG)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Synthetic tetrapeptide (Ala-Glu-Asp-Gly) derived from the pineal gland polypeptide epithalamin. The most extensively studied bioregulatory peptide for telomerase activation, with over 100 publications demonstrating telomere elongation in human somatic cells. Key compound in longevity and anti-aging research.

#### FOXO4-DRI

- URL: https://aminocoreresearch.com/peptides/foxo4-dri
- SKU: ACR-FOXO4
- CAS: 2074718-87-9
- Molecular formula: C218H335N61O73
- Molecular weight: 4827.00 g/mol
- Sequence: H-(D)-Leu-(D)-Thr-(D)-Leu-(D)-Arg-(D)-Lys(retro-inverso)-...-(FOXO4 DBD-binding D-retro-inverso peptide fused to a cell-penetrating sequence)
- Purity: ≥95%
- Form: Lyophilized Powder
- Storage: Store at -20°C

D-retro-inverso peptide disrupting FOXO4-p53 interaction. Studied for senescent cell biology and cellular senescence pathways.

#### Glutathione

- URL: https://aminocoreresearch.com/peptides/glutathione
- SKU: ACR-GSH
- CAS: 70-18-8
- Molecular formula: C10H17N3O6S
- Molecular weight: 307.32 g/mol
- Sequence: Glu-Cys-Gly (gamma-linkage)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Tripeptide antioxidant (Glu-Cys-Gly). The most abundant intracellular thiol compound, essential for cellular redox homeostasis research.

#### Humanin

- URL: https://aminocoreresearch.com/peptides/humanin
- SKU: HUM-001
- CAS: 330936-69-1
- Molecular formula: C₁₂₀H₂₀₈N₃₆O₃₃S₂
- Molecular weight: 2687.22 g/mol
- Sequence: MAPRGFSCLLLLTSEIDLPVKRRA
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Mitochondria-derived peptide (MDP) researched for potent cytoprotective and anti-apoptotic properties. Studied in neurodegeneration, Alzheimer disease models, and cellular stress.

#### Livagen

- URL: https://aminocoreresearch.com/peptides/livagen
- SKU: LIV-001
- CAS: 486998-49-4
- Molecular formula: C18H31N5O9
- Molecular weight: 461.47 g/mol
- Sequence: Lys-Glu-Asp-Ala (KEDA)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Hepatic bioregulatory tetrapeptide (Lys-Glu-Asp-Ala). Researched for liver function normalization and chromatin DNA decondensation effects.

#### Melatonin

- URL: https://aminocoreresearch.com/peptides/melatonin
- SKU: ACR-MELAT
- CAS: 73-31-4
- Molecular formula: C13H16N2O2
- Molecular weight: 232.28 g/mol
- Sequence: N/A (indoleamine)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

N-acetyl-5-methoxytryptamine. Endogenous indoleamine hormone studied for MT1/MT2 receptor signaling and circadian rhythm research.

#### NAD+

- URL: https://aminocoreresearch.com/peptides/nad
- SKU: ACR-NAD
- CAS: 53-84-9
- Molecular formula: C21H27N7O14P2
- Molecular weight: 663.43 g/mol
- Sequence: Not applicable — NAD+ is a dinucleotide coenzyme, not a peptide. Its structure consists of nicotinamide mononucleotide (NMN) linked to adenosine monophosphate (AMP) via a pyrophosphate bridge.
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Nicotinamide adenine dinucleotide (NAD+), a vital coenzyme central to over 500 enzymatic reactions including sirtuin-mediated deacetylation, PARP-dependent DNA repair, and mitochondrial oxidative phosphorylation. Age-related NAD+ decline has been linked to metabolic dysfunction and neurodegeneration in preclinical models.

#### SS-31 (Elamipretide)

- URL: https://aminocoreresearch.com/peptides/ss-31-elamipretide
- SKU: ACR-SS31
- CAS: 736992-21-5
- Molecular formula: C32H49N5O5
- Molecular weight: 571.77 g/mol
- Sequence: D-Arg-Dmt-Lys-Phe-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Mitochondria-targeted tetrapeptide. Studied for cardiolipin interaction and mitochondrial inner membrane stabilization research.

#### Thymalin

- URL: https://aminocoreresearch.com/peptides/thymalin
- SKU: ACR-THYM
- CAS: 37211-64-4
- Molecular formula: Not applicable (polypeptide complex)
- Molecular weight: Not applicable (heterogeneous mixture, ~1-10 kDa fractions)
- Sequence: Polypeptide complex (thymus-derived); no single defined sequence
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Thymalin is a thymus-derived polypeptide complex from the Khavinson cytomax line. As an extract it has no single defined sequence or molecular weight; the synthetic dipeptide counterpart is Thymogen (Glu-Trp). Supplied with a third-party certificate of analysis.

#### Thymogen

- URL: https://aminocoreresearch.com/peptides/thymogen
- SKU: ACR-THYMG
- CAS: 38101-59-6
- Molecular formula: C16H19N3O5
- Molecular weight: 333.34 g/mol
- Sequence: Glu-Trp (EW)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Thymogen is the synthetic dipeptide Glu-Trp (EW) from the Khavinson cytogen line, and the defined-sequence counterpart to the thymus-derived Thymalin complex. Supplied as lyophilized powder at ≥99% purity with a third-party certificate of analysis.

#### Vesilute (Vesilut)

- URL: https://aminocoreresearch.com/peptides/vesilut
- SKU: VESL-001
- CAS: 98929-91-4
- Molecular formula: C9H14N2O7
- Molecular weight: 262.22 g/mol
- Sequence: Glu-Asp (E-D)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Vesilute (Vesilut), also written ED, is the dipeptide Glu-Asp from the Khavinson short-peptide family. Its Glu-Asp sequence also occurs within Prostamax (Lys-Glu-Asp-Pro). Supplied as lyophilized powder with a third-party certificate of analysis.

#### Vesugen

- URL: https://aminocoreresearch.com/peptides/vesugen
- SKU: VES-001
- CAS: 70280-31-4
- Molecular formula: C15H26N4O8
- Molecular weight: 390.39 g/mol
- Sequence: Lys-Glu-Asp (KED)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Vascular bioregulatory tripeptide (Lys-Glu-Asp) from the Khavinson family. Researched for normalizing blood vessel function and cardiovascular health.


### Dermal & Cosmetic Research

#### AHK-Cu Topical

- URL: https://aminocoreresearch.com/peptides/ahk-cu-topical
- SKU: AHK-001
- Purity: ≥99%
- Form: Topical Solution
- Storage: Store at -20°C

Copper-binding tripeptide analog in topical formulation for hair follicle stimulation and dermal regeneration research. Related to GHK-Cu with enhanced follicular targeting.

#### Argireline (Acetyl Hexapeptide-3)

- URL: https://aminocoreresearch.com/peptides/argireline
- SKU: ARG-001
- CAS: 616204-22-9
- Molecular formula: C₃₄H₆₀N₁₄O₁₂S
- Molecular weight: 888.98 g/mol
- Sequence: Ac-EEMQRR-NH₂
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Acetyl hexapeptide-3 targeting the SNARE complex (SNAP-25 analog). Researched for reducing neurotransmitter release at the neuromuscular junction in cosmetic dermal studies.

#### Decapeptide-12

- URL: https://aminocoreresearch.com/peptides/decapeptide-12
- SKU: DECA12-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Tyrosinase-inhibiting decapeptide researched for skin tone regulation. Shown to reduce melanin production by competitively inhibiting the tyrosinase enzyme.

#### Lipopeptide (Pal-GHK-Lipopeptide)

- URL: https://aminocoreresearch.com/peptides/lipopeptide
- SKU: LIPO-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Fatty acid-conjugated peptide designed for enhanced dermal penetration. Studied for improved bioavailability in topical applications and skin rejuvenation research.

#### Matrixyl (Palmitoyl Pentapeptide-4)

- URL: https://aminocoreresearch.com/peptides/matrixyl
- SKU: MAT-001
- CAS: 214047-00-4
- Molecular formula: C₂₆H₄₅N₅O₈
- Molecular weight: 563.65 g/mol
- Sequence: Pal-KTTKS
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Palmitoyl pentapeptide-4 (Pal-KTTKS) widely researched for stimulating collagen I, III, and IV synthesis. Key compound in anti-aging and skin regeneration dermal studies.

#### Melanotan I

- URL: https://aminocoreresearch.com/peptides/melanotan-i
- SKU: ACR-MT1
- CAS: 75921-69-6
- Molecular weight: 1646.85 g/mol
- Sequence: [Nle4, D-Phe7]-alpha-MSH
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Linear alpha-MSH analog peptide (Afamelanotide). Studied for MC1R receptor selectivity and melanocortin pathway research.

#### Melanotan II (MT-2)

- URL: https://aminocoreresearch.com/peptides/melanotan-ii
- SKU: ACR-MT2
- CAS: 121062-08-6
- Molecular formula: C50H69N15O9
- Molecular weight: 1024.18 g/mol
- Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Cyclic heptapeptide analog of alpha-MSH targeting melanocortin receptors MC1R through MC5R. Originally developed at University of Arizona for melanogenesis research. Non-selective melanocortin agonist studied for tanning response, sexual function, appetite modulation, and immune regulation.

#### Nonapeptide-1

- URL: https://aminocoreresearch.com/peptides/nonapeptide-1
- SKU: NONA-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Alpha-MSH (melanocyte-stimulating hormone) antagonist researched for melanin regulation. Studied for inhibiting melanogenesis and skin pigmentation modulation.

#### Pal-GHK (Palmitoyl Tripeptide-1)

- URL: https://aminocoreresearch.com/peptides/pal-ghk
- SKU: PGHK-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Palmitoylated GHK fragment (palmitoyl tripeptide-1) for enhanced cellular uptake. Researched for stimulating collagen I and III synthesis in anti-aging dermal studies.

#### Palmitoyl Tetrapeptide-7

- URL: https://aminocoreresearch.com/peptides/palmitoyl-tetrapeptide-7
- SKU: PAL7-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Anti-inflammatory tetrapeptide researched for reducing interleukin-6 (IL-6) secretion. Studied for improving skin firmness and reducing glycation-related aging.

#### Pentapeptide-18 (Leuphasyl)

- URL: https://aminocoreresearch.com/peptides/pentapeptide-18
- SKU: PEP18-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Enkephalin-like pentapeptide researched for reducing catecholamine release at the neuromuscular junction. Mimics the activity of enkephalins in modulating pain signaling.

#### PTD-DBM (Hair Growth Peptide)

- URL: https://aminocoreresearch.com/peptides/ptd-dbm
- SKU: AC-PTDDBM
- Purity: Research Grade
- Form: Topical Solution
- Storage: Store at 2-8°C

Novel cell-penetrating peptide that activates the Wnt/β-catenin pathway in hair follicle dermal papilla cells. Preclinical studies demonstrate hair regrowth comparable to minoxidil without systemic effects. Key compound in hair loss and follicular regeneration research.

#### Snap-8

- URL: https://aminocoreresearch.com/peptides/snap-8
- SKU: ACR-SNAP8
- CAS: 868844-74-0
- Molecular weight: 1075.14 g/mol
- Sequence: Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Snap-8 (Acetyl Octapeptide-3) is an eight-amino acid peptide derived from the N-terminus of SNAP-25, studied in cell culture for its interaction with the SNARE complex and modulation of vesicle fusion. It is an extended analog of Argireline (acetyl hexapeptide-3) with two additional amino acids.

#### Syn-AKE (Dipeptide Diaminobutyroyl)

- URL: https://aminocoreresearch.com/peptides/syn-ake
- SKU: SYNK-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Synthetic tripeptide mimicking Waglerin-1 temple viper venom. Researched for nicotinic acetylcholine receptor antagonism and muscle relaxation in dermal cosmetic applications.

#### Syn-Coll (Palmitoyl Tripeptide-5)

- URL: https://aminocoreresearch.com/peptides/syn-coll
- SKU: SYNC-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Palmitoyl tripeptide-5 functioning as a TGF-beta mimetic. Researched for stimulating collagen production via the TGF-beta signaling pathway and improving skin elasticity.

#### Tripeptide-29

- URL: https://aminocoreresearch.com/peptides/tripeptide-29
- SKU: TRI29-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Collagen fragment tripeptide (GHK analog) researched for stimulating collagen type I and III production. Small peptide with high skin penetration for dermal studies.

#### Vialox (Pentapeptide-3V)

- URL: https://aminocoreresearch.com/peptides/vialox
- SKU: VIA-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Pentapeptide-3V functioning as a competitive antagonist of the post-synaptic acetylcholine receptor. Researched for muscle relaxation and expression line reduction.


### Growth Hormone Axis

#### CJC-1295 (no DAC)

- URL: https://aminocoreresearch.com/peptides/cjc-1295-no-dac
- SKU: ACR-CJC1295
- CAS: 863288-34-0
- Molecular formula: C152H252N44O42
- Molecular weight: 3367.97 g/mol
- Sequence: 30-amino acid GHRH analog
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Modified Growth Hormone Releasing Hormone analog without Drug Affinity Complex. 30-amino acid GHRH analog with enhanced receptor affinity.

#### CJC-1295 DAC

- URL: https://aminocoreresearch.com/peptides/cjc-1295-dac
- SKU: ACR-CJC1295D
- CAS: 863288-34-0
- Molecular formula: C165H269N47O46
- Molecular weight: 3647.16 g/mol
- Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(MPA)-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

CJC-1295 DAC (DAC:GRF) is a 30-amino acid GHRH(1-29) analog conjugated to a maleimidopropionyl-lysine Drug Affinity Complex that covalently binds serum albumin, extending its half-life to approximately 8 days. Used in growth hormone axis research to investigate sustained GHRH receptor activation and pulsatile GH/IGF-1 secretion.

#### GHRP-2

- URL: https://aminocoreresearch.com/peptides/ghrp-2
- SKU: ACR-GHRP2
- CAS: 158861-67-7
- Molecular formula: C45H55N9O6
- Molecular weight: 817.98 g/mol
- Sequence: D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Growth Hormone Releasing Peptide-2 is a synthetic hexapeptide with documented high receptor affinity for GHS-R1a in published binding studies.

#### GHRP-6

- URL: https://aminocoreresearch.com/peptides/ghrp-6
- SKU: ACR-GHRP6
- CAS: 87616-84-0
- Molecular formula: C46H56N12O6
- Molecular weight: 873.01 g/mol
- Sequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Growth Hormone Releasing Peptide-6 is a synthetic hexapeptide GHS-R1a agonist. One of the earliest characterized growth hormone secretagogues.

#### Hexarelin

- URL: https://aminocoreresearch.com/peptides/hexarelin
- SKU: ACR-HEXA
- CAS: 140703-51-1
- Molecular formula: C47H58N12O6
- Molecular weight: 887.04 g/mol
- Sequence: His-D-2-MeTrp-Ala-Trp-D-Phe-Lys-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Synthetic hexapeptide growth hormone secretagogue with documented high potency at GHS-R1a. His-D-2-MeTrp-Ala-Trp-D-Phe-Lys-NH2.

#### Ipamorelin

- URL: https://aminocoreresearch.com/peptides/ipamorelin
- SKU: ACR-IPAM
- CAS: 170851-70-4
- Molecular formula: C38H49N9O5
- Molecular weight: 711.85 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Selective growth hormone secretagogue pentapeptide. Studied for its GHS-R1a receptor selectivity in published research.

#### MK-677 (Ibutamoren)

- URL: https://aminocoreresearch.com/peptides/mk-677
- SKU: MK677-001
- CAS: 159752-10-0
- Molecular formula: C₂₇H₃₆N₄O₅S
- Molecular weight: 528.66 g/mol
- Sequence: Non-peptide small molecule (no amino acid sequence). IUPAC: 2-amino-2-methyl-N-[(2R)-1-(1-methanesulfonylspiro[indoline-3,4'-piperidine]-1'-yl)-1-oxo-3-(phenylmethoxy)propan-2-yl]propanamide
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Selective, non-peptide ghrelin receptor agonist (GHS-R1a) that stimulates pulsatile growth hormone release without disrupting the natural GH secretion pattern. Orally bioavailable research compound for GH axis studies.

#### Sermorelin

- URL: https://aminocoreresearch.com/peptides/sermorelin
- SKU: ACR-SERM
- CAS: 86168-78-7
- Molecular formula: C149H246N44O42S
- Molecular weight: 3357.88 g/mol
- Sequence: GHRH(1-29)-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

GHRH(1-29) analog, the shortest fully functional fragment of growth hormone releasing hormone. 29 amino acid peptide for receptor studies.


### Hormonal Signaling Studies

#### Gonadorelin

- URL: https://aminocoreresearch.com/peptides/gonadorelin
- SKU: ACR-GNRH
- CAS: 33515-09-2
- Molecular formula: C55H75N17O13
- Molecular weight: 1182.29 g/mol
- Sequence: pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Synthetic decapeptide identical to endogenous gonadotropin-releasing hormone (GnRH). Used in receptor binding and signaling studies.

#### HCG

- URL: https://aminocoreresearch.com/peptides/hcg
- SKU: ACR-HCG
- CAS: 9002-61-3
- Molecular formula: C1105H1770N318O336S26
- Molecular weight: 36700.00 g/mol
- Sequence: Glycoprotein heterodimer
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Human Chorionic Gonadotropin (hCG) is a heterodimeric glycoprotein hormone composed of alpha and beta subunits that activates the LH/CG receptor (LHCGR). It is studied extensively for gonadal steroidogenesis, Leydig cell function, and reproductive endocrinology research.

#### HMG

- URL: https://aminocoreresearch.com/peptides/hmg
- SKU: ACR-HMG
- CAS: 9002-68-0
- Molecular formula: Mixed glycoprotein (FSH + LH)
- Molecular weight: ~30,000-34,000 Da (heterodimeric glycoproteins)
- Sequence: FSH + LH glycoproteins
- Purity: ≥97%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Human Menopausal Gonadotropin containing FSH and LH activity. Studied for gonadotropin receptor interactions in reproductive biology research.

#### Kisspeptin-10

- URL: https://aminocoreresearch.com/peptides/kisspeptin-10
- SKU: ACR-KISS10
- CAS: 374675-21-5
- Molecular formula: C63H83N17O14
- Molecular weight: 1302.46 g/mol
- Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

C-terminal decapeptide fragment of kisspeptin. Studied for its activation of the GPR54 (KISS1R) receptor in endocrine research.

#### Ovagen

- URL: https://aminocoreresearch.com/peptides/ovagen
- SKU: OVA-001
- CAS: 98249-67-5
- Molecular formula: C15H25N3O8
- Molecular weight: 375.38 g/mol
- Sequence: Glu-Asp-Leu (H-Glu-Asp-Leu-OH)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Hepatic bioregulatory tripeptide (Glu-Asp-Leu). Researched for liver function normalization and lipid metabolism regulation in aging models.

#### Oxytocin Acetate

- URL: https://aminocoreresearch.com/peptides/oxytocin-acetate
- SKU: ACR-OXY
- CAS: 6233-83-6
- Molecular formula: C43H66N12O12S2
- Molecular weight: 1007.19 g/mol
- Sequence: Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Cyclic nonapeptide hormone. Studied for oxytocin receptor signaling, social behavior neuroscience, and smooth muscle physiology research.

#### Prostamax

- URL: https://aminocoreresearch.com/peptides/prostamax
- SKU: PRMAX-001
- CAS: 1421139-86-3
- Molecular formula: C20H33N5O9
- Molecular weight: 487.51 g/mol
- Sequence: Lys-Glu-Asp-Pro (KEDP)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Prostate-specific bioregulatory tetrapeptide (Lys-Glu-Asp-Pro). Researched for normalizing prostate gland function in aging models.

#### PT-141

- URL: https://aminocoreresearch.com/peptides/pt-141
- SKU: ACR-PT141
- CAS: 189691-06-3
- Molecular formula: C50H68N14O10
- Molecular weight: 1,025.18 g/mol
- Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Cyclic heptapeptide melanocortin receptor agonist (MC3R/MC4R) derived from alpha-MSH. Demonstrates CNS-mediated activity distinct from peripheral vasodilators. FDA-approved analog (Vyleesi/bremelanotide) validated the melanocortin pathway in hypoactive sexual desire disorder (HSDD). Key research tool for melanocortin signaling, appetite regulation, inflammation, and ischemia-reperfusion studies.

#### Testagen

- URL: https://aminocoreresearch.com/peptides/testagen
- SKU: AC-TESTG
- CAS: 59785-58-3
- Molecular formula: C17H29N5O9
- Molecular weight: 447.45 g/mol
- Sequence: H-Lys-Glu-Asp-Gly-OH
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Khavinson bioregulatory tetrapeptide (Lys-Glu-Asp-Gly) for testicular function and testosterone regulation research. Normalizes Leydig cell gene expression and steroidogenic enzyme activity in aging models.

#### Thyrotropin (TSH)

- URL: https://aminocoreresearch.com/peptides/thyrotropin-tsh
- SKU: TSH-001
- CAS: 9002-71-5
- Molecular formula: C1539H2406N418O474S20
- Molecular weight: 28,000 Da
- Sequence: Alpha subunit (92 aa): APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; Beta subunit (118 aa): FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Thyroid-stimulating hormone (TSH) glycoprotein analog for endocrine system research. Key compound in hypothalamic-pituitary-thyroid axis studies and thyroid function research.

#### Triptorelin

- URL: https://aminocoreresearch.com/peptides/triptorelin
- SKU: TRIP-001
- CAS: 57773-63-4
- Molecular formula: C₆₄H₈₂N₁₈O₁₃
- Molecular weight: 1311.45 g/mol
- Sequence: pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH₂
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Synthetic decapeptide GnRH agonist (gonadotropin-releasing hormone analog) for reproductive endocrinology research. Studied for LH/FSH modulation and hormonal signaling pathways.


### Immune Modulation

#### 5-Amino-1MQ

- URL: https://aminocoreresearch.com/peptides/5-amino-1mq
- SKU: ACR-5A1MQ
- CAS: 1801997-83-8
- Molecular formula: C7H9N2+
- Molecular weight: 121.16 g/mol (free base); 257.07 g/mol (diiodide salt)
- Sequence: Small molecule (not a peptide): 5-amino-1-methylquinolinium
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Selective NNMT (nicotinamide N-methyltransferase) inhibitor researched for metabolic regulation, adipogenesis inhibition, and energy expenditure modulation.

#### Bronchogen

- URL: https://aminocoreresearch.com/peptides/bronchogen
- SKU: BRON-001
- CAS: 344417-94-1
- Molecular formula: C18H30N4O9
- Molecular weight: 446.46 g/mol
- Sequence: Ala-Glu-Asp-Leu (AEDL)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Bronchial tissue bioregulatory tetrapeptide (Ala-Glu-Asp-Leu). Researched for normalizing respiratory epithelium function and bronchial mucosa health.

#### Chonluten

- URL: https://aminocoreresearch.com/peptides/chonluten
- SKU: CHON-001
- CAS: 164365-43-3
- Molecular formula: C13H21N3O9
- Molecular weight: 363.32 g/mol
- Sequence: Thr-Glu-Asp (TED)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Bronchial mucosa bioregulatory tripeptide (Thr-Glu-Asp). Researched for respiratory immune modulation and mucosal epithelium normalization.

#### KPV

- URL: https://aminocoreresearch.com/peptides/kpv
- SKU: ACR-KPV
- CAS: 67727-97-3
- Molecular formula: C16H31N5O4
- Molecular weight: 357.45 g/mol
- Sequence: Lys-Pro-Val
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

C-terminal tripeptide fragment of alpha-MSH. Studied for NF-kB pathway modulation and anti-inflammatory signaling research.

#### LL-37

- URL: https://aminocoreresearch.com/peptides/ll-37
- SKU: ACR-LL37
- CAS: 154947-66-7
- Molecular formula: C205H340N60O53
- Molecular weight: 4493.33 g/mol
- Sequence: [LL-37, 37 aa]
- Purity: ≥95%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Human cathelicidin antimicrobial peptide. A 37-amino acid peptide studied in innate immunity and host defense peptide research.

#### PNC-27 (p53-MDM2 Inhibitor)

- URL: https://aminocoreresearch.com/peptides/pnc-27
- SKU: AC-PNC27
- CAS: 402958-96-9
- Molecular formula: C160H260N44O36
- Molecular weight: 3338.04 g/mol
- Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Purity: Research Grade
- Form: Lyophilized Powder
- Storage: Store at -20°C

Anticancer peptide derived from the p53 tumor suppressor protein. Targets HDM-2 binding site on cancer cell membranes, inducing selective necrosis of transformed cells while sparing normal tissue. Key compound in targeted cancer peptide research.

#### Thymosin Alpha-1

- URL: https://aminocoreresearch.com/peptides/thymosin-alpha-1
- SKU: ACR-TA1
- CAS: 62304-98-7
- Molecular formula: C129H215N33O55
- Molecular weight: 3108.28 g/mol
- Sequence: Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

A 28-amino acid peptide derived from prothymosin alpha. Studied for immune modulation and T-cell differentiation pathways.

#### Vilon

- URL: https://aminocoreresearch.com/peptides/vilon
- SKU: VIL-001
- CAS: 98815-38-4
- Molecular formula: C11H21N3O5
- Molecular weight: 275.30 g/mol
- Sequence: Lys-Glu (H-Lys-Glu-OH)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Thymic bioregulatory dipeptide (Lys-Glu) from the Khavinson peptide family. Researched for immunomodulatory properties, T-cell activation, and thymus function.

#### VIP (Vasoactive Intestinal Peptide)

- URL: https://aminocoreresearch.com/peptides/vip-vasoactive-intestinal-peptide
- SKU: ACR-VIP
- CAS: 37221-79-7
- Molecular formula: C147H237N43O44S
- Molecular weight: 3,326.83 g/mol
- Sequence: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

28-amino acid neuropeptide with pleiotropic functions across immune, nervous, and gastrointestinal systems. Activates VPAC1 and VPAC2 receptors (class B GPCRs) to regulate inflammation, circadian rhythm, neuroprotection, bronchodilation, and gut motility. One of the most multi-functional endogenous peptides known.


### Metabolic Modulators & Exercise Mimetics

#### Adipotide (FTPP)

- URL: https://aminocoreresearch.com/peptides/adipotide-ftpp
- SKU: ACR-ADIPO
- CAS: 868851-47-0
- Molecular formula: C112H166N32O27S
- Molecular weight: 2436.81 g/mol
- Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
- Purity: ≥97%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Adipotide (FTPP) is a chimeric peptidomimetic combining a CKGGRAKDC homing motif that binds prohibitin on white adipose vasculature with a D(KLAKLAK)2 proapoptotic domain. It has been studied in preclinical models for selective ablation of adipose endothelium.

#### AICAR

- URL: https://aminocoreresearch.com/peptides/aicar
- SKU: ACR-AICAR
- CAS: 2627-69-2
- Molecular formula: C9H14N4O5
- Molecular weight: 258.23 g/mol
- Sequence: N/A (nucleoside analog)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

5-Aminoimidazole-4-carboxamide ribonucleoside. An AMPK activator studied extensively in metabolic and exercise physiology research.

#### AOD-9604

- URL: https://aminocoreresearch.com/peptides/aod-9604
- SKU: ACR-AOD9604
- CAS: 221231-10-3
- Molecular formula: C78H123N23O23S2
- Molecular weight: 1815.08 g/mol
- Sequence: hGH fragment 176-191
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Modified fragment of human growth hormone (hGH 176-191). A synthetic peptide fragment studied in metabolic research.

#### HGH Fragment 176-191

- URL: https://aminocoreresearch.com/peptides/hgh-fragment-176-191
- SKU: ACR-HGH191
- CAS: 221231-10-3
- Molecular formula: C78H125N23O23S2
- Molecular weight: 1,817.12 g/mol
- Sequence: 191-amino acid sequence
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Human Growth Hormone full-length 191 amino acid sequence. Recombinant somatotropin for growth hormone receptor binding research.

#### MOTS-c

- URL: https://aminocoreresearch.com/peptides/mots-c
- SKU: ACR-MOTSC
- CAS: 1627580-64-6
- Molecular formula: C101H152N28O22S2
- Molecular weight: 2,174.64 g/mol
- Sequence: MRWQEMGYIFYPRKLR
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Mitochondria-derived peptide (MDP) encoded by mitochondrial 12S rRNA gene. 16 amino acids activating AMPK and regulating glucose metabolism in skeletal muscle. The first mitochondrial-encoded peptide shown to act as an exercise mimetic with systemic metabolic effects.

#### SLU-PP-332

- URL: https://aminocoreresearch.com/peptides/slu-pp-332
- SKU: ACR-SLUPP
- CAS: 2410279-67-7
- Molecular formula: C27H25N3O4S
- Molecular weight: 487.57 g/mol
- Sequence: N/A (small molecule)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

SLU-PP-332 is a pan-agonist of the estrogen-related receptors (ERRα, ERRβ, ERRγ) developed at Saint Louis University. Preclinical research has shown it activates mitochondrial biogenesis, fatty acid oxidation, and exercise-like transcriptional programs in skeletal muscle, earning its classification as an exercise mimetic.

#### SLU-PP-332 Capsules

- URL: https://aminocoreresearch.com/peptides/slu-pp-332-capsules
- SKU: ACR-SLUPP-C60
- CAS: 2138873-72-6
- Molecular formula: C21H21F3N2O4
- Molecular weight: 422.40 g/mol
- Sequence: N/A — small molecule (not a peptide)
- Purity: ≥99%
- Form: Capsule
- Storage: Store sealed at room temperature, away from light and humidity

Oral capsule presentation of SLU-PP-332 at 250 mcg per capsule, 60 capsules per bottle. A small molecule, not a peptide — which is what makes the oral format feasible.

#### Tesamorelin

- URL: https://aminocoreresearch.com/peptides/tesamorelin
- SKU: ACR-TESA
- CAS: 804475-66-9
- Molecular formula: C221H366N72O67S
- Molecular weight: 5135.88 g/mol
- Sequence: Modified GHRH(1-44)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Tesamorelin (TH9507), a synthetic GHRH analog carrying a trans-3-hexenoic acid modification on the N-terminal tyrosine. A 44-amino-acid peptide studied for growth hormone axis signalling, supplied at ≥99% HPLC purity with a batch-specific COA.

#### Vitamin B12

- URL: https://aminocoreresearch.com/peptides/vitamin-b12
- SKU: ACR-B12
- CAS: 13422-55-4
- Molecular formula: C63H91CoN13O14P
- Molecular weight: 1344.38 g/mol
- Sequence: N/A (cobalamin coenzyme; not a peptide)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Methylcobalamin form of vitamin B12 for neurological function and methylation pathway research. Injectable research-grade formulation.


### Metabolic Pathway Research

#### Cagrilintide

- URL: https://aminocoreresearch.com/peptides/cagrilintide
- SKU: ACR-CAGRI
- CAS: 2196264-78-9
- Molecular formula: C185H276N48O56S3
- Molecular weight: 4,003 g/mol (est.)
- Sequence: Modified amylin analog
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Long-acting amylin analog acylated peptide. Studied for its interaction with amylin receptors and metabolic signaling pathways in preclinical models.

#### Lemon Bottle

- URL: https://aminocoreresearch.com/peptides/lemon-bottle
- SKU: ACR-LEMON
- CAS: N/A (proprietary blend; riboflavin CAS 83-88-5, lecithin CAS 8002-43-5, bromelain CAS 9001-00-7)
- Molecular formula: Proprietary blend (riboflavin C17H20N4O6, lecithin/phosphatidylcholine, bromelain enzyme complex)
- Molecular weight: Proprietary blend (riboflavin 376.36 g/mol; phosphatidylcholine ~760 g/mol; bromelain ~28 kDa)
- Sequence: N/A — multi-component formulation (vitamin B2 + phospholipid + proteolytic enzyme); not a defined peptide sequence
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Proprietary lipolytic research compound containing riboflavin, lecithin, and bromelain. Studied for localized fat dissolution and adipocyte lysis mechanisms.

#### Mazdutide

- URL: https://aminocoreresearch.com/peptides/mazdutide
- SKU: ACR-MAZDU
- CAS: 2259884-37-2
- Molecular formula: C172H265N43O51
- Molecular weight: 3781.32 g/mol
- Sequence: HSQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSGAPPPSK (with C16 fatty acid modification at Lys10)
- Purity: ≥97%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Dual GLP-1/glucagon receptor agonist peptide. Studied for incretin pathway co-activation and metabolic signaling research.

#### NA-931 (Quadruple Agonist) · `NA-931`

- URL: https://aminocoreresearch.com/peptides/na-931-quadruple-agonist
- Short URL: https://aminocoreresearch.com/sku/NA-931
- SKU: AC-NA931
- CAS: Not yet assigned (investigational)
- Molecular formula: C168H261N45O52
- Molecular weight: 3,775.2 g/mol
- Sequence: Proprietary cyclic peptide derived from IGF-1 metabolite fragment (full sequence undisclosed by sponsor)
- Purity: Research Grade
- Form: Lyophilized Powder
- Storage: Store at -20°C

First-in-class oral quadruple receptor agonist targeting GLP-1, GIP, glucagon, and IGF-1 receptors simultaneously. Developed by an investigational sponsor from a cyclic IGF-1 metabolite fragment. Phase 2 data: -9.2% body weight at 12 weeks via oral administration.

#### Orforglipron Capsules

- URL: https://aminocoreresearch.com/peptides/orforglipron-capsules
- SKU: ACR-ORFO-C90
- CAS: 2212020-52-3
- Molecular formula: C37H45F2N9O4
- Molecular weight: 717.82 g/mol
- Sequence: Non-peptide small molecule (no amino acid sequence)
- Purity: ≥99%
- Form: Capsule
- Storage: Store sealed at room temperature, away from light and humidity

Oral capsule presentation of orforglipron at 6 mg per capsule, 90 capsules per bottle. A non-peptide small-molecule GLP-1 receptor agonist — the property that makes an oral format viable.

#### Pancragen

- URL: https://aminocoreresearch.com/peptides/pancragen
- SKU: PANC-001
- CAS: 175026-95-2
- Molecular formula: C26H36N6O9
- Molecular weight: 576.61 g/mol
- Sequence: H-Lys-Glu-Asp-Trp-OH
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Pancreatic bioregulatory tetrapeptide (Lys-Glu-Asp-Trp). Researched for insulin regulation, beta-cell function, and metabolic pathway normalization.

#### Retatrutide (RETA) · `RETA`

- URL: https://aminocoreresearch.com/peptides/retatrutide
- Short URL: https://aminocoreresearch.com/sku/RETA
- SKU: AC-AMGLP3
- CAS: 2381089-83-2
- Molecular formula: C221H343N45O68
- Molecular weight: 4731.45 g/mol
- Sequence: Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-αMeLeu-Leu-Asp-Lys-Lys(C20 diacid-γGlu-AEEA)-Ala-Gln-Aib-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

First-in-class triple hormone receptor agonist targeting GLP-1, GIP, and glucagon receptors simultaneously. 39-amino acid peptide with once-weekly pharmacokinetics. Phase 2 trials demonstrated up to 24.2% body metabolic regulation research — the highest reported for any single anti-metabolic syndrome research compound.

#### Super Shredder Blend · `AC-SSH`

- URL: https://aminocoreresearch.com/peptides/super-shredder-blend
- Short URL: https://aminocoreresearch.com/sku/AC-SSH
- SKU: ACR-BL-SS
- CAS: N/A (Multi-Component Blend)
- Molecular formula: Blend - Multiple Compounds
- Molecular weight: Variable (blend formulation)
- Sequence: Blend of: AOD-9604 (HRDKVFGANSLYQRQNHYDLDFGTHHITDFLKVAEEYLLKK-COOH 16 aa C-terminal fragment hGH 177-191 with Tyr addition), CJC-1295 (Y-D-Ala-DAEFRHDS-Aib-EERQKLIQLYRSLHQLAAK with optional DAC), Ipamorelin (Aib-His-D-2-Nal-D-Phe-Lys-NH2), and Tesamorelin (trans-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Multi-component metabolic research blend (L-carnitine, MIC complex, ATP and cofactors) supplied for in-vitro study of the carnitine-shuttle and hepatic lipid-metabolism pathways.

#### Survodutide

- URL: https://aminocoreresearch.com/peptides/survodutide
- SKU: ACR-SURVO
- CAS: 2407991-90-6
- Molecular formula: C189H288N48O57
- Molecular weight: 4205.7 g/mol
- Sequence: H-His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Lys-Lys-Ala-Lys-Glu-Phe-Val-Glu-Trp-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-OH (Lys17 and Lys20 modified with fatty acid chain via γGlu linker)
- Purity: ≥97%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Dual glucagon/GLP-1 receptor agonist peptide. Studied for dual incretin receptor co-activation and metabolic pathway research.

#### Tirzepatide (TIRZ) · `TIRZ`

- URL: https://aminocoreresearch.com/peptides/tirzepatide
- Short URL: https://aminocoreresearch.com/sku/TIRZ
- SKU: AC-AMGLP2
- CAS: 2023788-19-2
- Molecular formula: C225H348N48O68
- Molecular weight: 4813.45 g/mol
- Sequence: YXEGTFTSDYSIXLDKIAQKAFVQWLIAGGPSSGAPPPS (X = Aib at positions 2 and 13; Lys20 conjugated to γGlu-C18 fatty diacid)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Dual GLP-1/GIP receptor agonist (twincretin) with once-weekly pharmacokinetics. 39-amino acid GIP-backbone peptide with Aib2/Aib13 modifications and C-20 fatty diacid conjugation. comparative trial Phase 3: -20.9% body metabolic regulation research. First dual incretin studied for metabolic syndrome research.


### Muscle Growth & Performance

#### ACE-031

- URL: https://aminocoreresearch.com/peptides/ace-031
- SKU: ACR-ACE031
- CAS: 1262787-44-1
- Molecular formula: Fc-fusion protein (recombinant)
- Molecular weight: ~78-80 kDa (dimer ~150 kDa)
- Sequence: Extracellular domain of human ActRIIB (residues 19-134) fused to human IgG1 Fc domain
- Purity: ≥95%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Soluble form of activin receptor type IIB (ActRIIB-Fc). Studied for myostatin/activin pathway inhibition research.

#### Follistatin 344

- URL: https://aminocoreresearch.com/peptides/follistatin-344
- SKU: ACR-FOLL
- CAS: 80449-31-6
- Molecular formula: C1606H2537N437O510S33
- Molecular weight: 36000 g/mol (approx., glycosylated)
- Sequence: GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN (344 aa mature)
- Purity: ≥97%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Single-chain glycoprotein that binds and neutralizes activin. Studied for TGF-beta superfamily signaling and myostatin pathway research.

#### IGF-1 DES

- URL: https://aminocoreresearch.com/peptides/igf-1-des
- SKU: ACR-IGFDES
- CAS: 112603-35-7
- Molecular formula: C331H512N94O101S7
- Molecular weight: 7365.39 g/mol
- Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Des(1-3) IGF-1 is a truncated IGF-1 variant lacking the first three N-terminal amino acids, studied for its reduced affinity to IGF-binding proteins (IGFBPs) in receptor-signaling research.

#### IGF-1 LR3

- URL: https://aminocoreresearch.com/peptides/igf-1-lr3
- SKU: ACR-IGF1LR3
- CAS: 946870-92-4
- Molecular formula: C400H625N111O115S9
- Molecular weight: 9117.50 g/mol
- Sequence: 83-amino acid modified IGF-1
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Long R3 Insulin-like Growth Factor-1 is a modified 83-amino acid analog of IGF-1 with extended half-life. Studied for cell proliferation and growth signaling pathways.

#### MGF (Mechano Growth Factor)

- URL: https://aminocoreresearch.com/peptides/mgf-mechano-growth-factor
- SKU: ACR-MGF
- CAS: 62031-54-3
- Molecular formula: C121H200N42O39
- Molecular weight: 2867.14 g/mol
- Sequence: 24-amino acid IGF-1 splice variant
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Splice variant of IGF-1 expressed in response to mechanical stimulation. 24-amino acid peptide studied for muscle biology research.

#### PEG-MGF

- URL: https://aminocoreresearch.com/peptides/peg-mgf
- SKU: PEGMGF-001
- CAS: 108174-48-7
- Molecular formula: C121H200N42O39
- Molecular weight: 2867.13 g/mol
- Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys (PEGylated at N-terminus)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

PEGylated form of Mechano Growth Factor with enhanced bioavailability and extended half-life. Studied for skeletal muscle hypertrophy, satellite cell activation, and recovery research.


### Pain & Nociception Research

#### Dermorphin

- URL: https://aminocoreresearch.com/peptides/dermorphin
- SKU: ACR-DERM
- CAS: 77614-16-5
- Molecular formula: C40H50N8O8S
- Molecular weight: 802.94 g/mol
- Sequence: H-Tyr-D-Ala-Phe-Gly-Tyr-Pro-Ser-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

A 7-amino acid opioid peptide originally isolated from the skin of South American frogs. Highly selective mu-opioid receptor agonist.


### Tissue Repair & Regeneration

#### ARA-290 (Cibinetide)

- URL: https://aminocoreresearch.com/peptides/ara-290-cibinetide
- SKU: ACR-ARA290
- CAS: 1208243-50-8
- Molecular formula: C55H89N17O15
- Molecular weight: 1260.52 g/mol
- Sequence: Pyr-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser (QEQLERALNSS, N-terminal pyroglutamate)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Innate repair receptor (IRR) agonist peptide. 11-amino acid peptide derived from erythropoietin helix B surface.

#### BPC-157

- URL: https://aminocoreresearch.com/peptides/bpc-157
- SKU: ACR-BPC157
- CAS: 137525-51-0
- Molecular formula: C62H98N16O22
- Molecular weight: 1419.53 g/mol
- Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Pentadecapeptide (15 amino acids) derived from human gastric juice protein. Extensively researched for tissue repair, angiogenesis, wound healing, tendon recovery, gastrointestinal protection, and neuroprotective mechanisms. One of the most studied regenerative peptides in preclinical literature.

#### BPC-157 Capsules

- URL: https://aminocoreresearch.com/peptides/bpc-157-capsules
- SKU: ACR-BPC-C60
- CAS: 137525-51-0
- Molecular formula: C62H98N16O22
- Molecular weight: 1419.53 g/mol
- Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- Purity: ≥99%
- Form: Capsule
- Storage: Store sealed at room temperature, away from light and humidity

Oral capsule presentation of BPC-157 at 500 mcg per capsule, 60 capsules per bottle. The peptide the literature describes as stable in gastric juice — the property that makes an oral format worth investigating.

#### GHK-Cu

- URL: https://aminocoreresearch.com/peptides/ghk-cu
- SKU: ACR-GHKCU
- CAS: 49557-75-7
- Molecular formula: C14H24CuN6O4
- Molecular weight: 403.93 g/mol
- Sequence: Gly-His-Lys:Cu(II)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Copper tripeptide complex (glycyl-L-histidyl-L-lysine copper). Studied in cell culture for gene expression modulation.

#### TB-500

- URL: https://aminocoreresearch.com/peptides/tb-500
- SKU: ACR-TB500
- CAS: 77591-33-4
- Molecular formula: C212H350N56O78S
- Molecular weight: 4963.44 g/mol
- Sequence: 43-amino acid sequence
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Thymosin Beta-4 fragment peptide. A 43-amino acid peptide originally isolated from thymus tissue, studied extensively in cell biology research.


### Peptide Blends

#### AOD-9604 + Tesamorelin + MOTS-c Blend · `AC-ATM`

- URL: https://aminocoreresearch.com/peptides/aod-9604-tesamorelin-mots-c-blend
- Short URL: https://aminocoreresearch.com/sku/AC-ATM
- SKU: ACR-BL-ATM
- Sequence: Multi-peptide blend
- Purity: ≥97%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Triple-peptide research blend combining AOD-9604, Tesamorelin, and MOTS-c for multi-pathway metabolic research protocols.

#### CJC-1295 (no DAC) + Ipamorelin Blend · `AC-CIB`

- URL: https://aminocoreresearch.com/peptides/cjc-1295-no-dac-ipamorelin-blend
- Short URL: https://aminocoreresearch.com/sku/AC-CIB
- SKU: ACR-BL-CI
- CAS: 863288-34-0 (CJC-1295 no DAC) / 170851-70-4 (Ipamorelin)
- Molecular formula: C231H354N62O60S (CJC-1295 no DAC: C165H269N47O46) + (Ipamorelin: C38H49N9O5)
- Molecular weight: Combined: ~4453.4 g/mol (CJC-1295 no DAC: 3367.95 g/mol; Ipamorelin: 711.86 g/mol)
- Sequence: CJC-1295 (no DAC): H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 | Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Research blend pairing CJC-1295 (no DAC), a tetra-substituted GHRH(1-29) analog, with Ipamorelin, a selective pentapeptide GHS-R1a agonist, to study synergistic pulsatile growth hormone release via dual GHRH/ghrelin receptor activation.

#### Fragment/CJC/Ipamorelin Blend

- URL: https://aminocoreresearch.com/peptides/fragment-cjc-ipamorelin-blend
- SKU: FCIB-001
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Triple-action growth hormone axis research blend: HGH Fragment 176-191 (lipolysis) + CJC-1295 (GHRH analog) + Ipamorelin (GHS). Synergistic GH research compound.

#### GLOW - BPC-157 | TB-500 | GHK-Cu · `AC-GLW`

- URL: https://aminocoreresearch.com/peptides/glow-peptide
- Short URL: https://aminocoreresearch.com/sku/AC-GLW
- SKU: ACR-GLOW70
- CAS: BPC-157: 137525-51-0; TB-500: 77591-33-4; GHK-Cu: 89030-95-5
- Molecular formula: Blend (BPC-157: C62H98N16O22; TB-500: C212H350N56O78S; GHK-Cu: C14H24N6O4·Cu)
- Molecular weight: BPC-157: 1,419.53 g/mol; TB-500: 4,963.44 g/mol; GHK-Cu: 403.93 g/mol
- Sequence: BPC-157: GEPPPGKPADDAGLV; TB-500 (Thymosin Beta-4 fragment 17-23, acetylated): Ac-LKKTETQ; GHK-Cu: Glycyl-L-Histidyl-L-Lysine:Copper(II)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

GLOW is a triple-peptide research blend combining BPC-157, TB-500, and GHK-Cu to investigate parallel pathways of tissue repair, angiogenesis, and extracellular matrix remodeling. Each constituent peptide is supplied at ≥99% HPLC purity for in vitro and preclinical research applications.

#### GLOW+ — BPC-157 | TB-500 | GHK-Cu | Thymosin Alpha-1 · `AC-GLWP`

- URL: https://aminocoreresearch.com/peptides/glow-bpc-157-tb-500-ghk-cu-thymosin-alpha-1
- Short URL: https://aminocoreresearch.com/sku/AC-GLWP
- SKU: ACR-GLOWPLUS
- CAS: 137525-51-0 / 49557-75-7 / 77591-33-4 / 62304-98-7
- Molecular weight: BPC-157: 1419.54 Da | GHK-Cu: 403.96 Da | TB-500: 4963.44 Da | Ta1: 3108.28 Da
- Sequence: BPC-157 + GHK-Cu + TB-500 + Thymosin Alpha-1
- Purity: >=99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Quad-peptide regeneration blend with BPC-157, GHK-Cu, TB-500 and Thymosin Alpha-1. Enhanced GLOW formula with immune-modulating Ta1 for tissue repair, skin rejuvenation and immune support research.

#### HHSN Blend - Hair, Skin & Nails · `AC-HSN`

- URL: https://aminocoreresearch.com/peptides/hhsn-blend-hair-skin-nails
- Short URL: https://aminocoreresearch.com/sku/AC-HSN
- SKU: ACR-BL-HHSN
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Multi-peptide blend formulated for dermal and follicular research. Combines growth factors and copper peptides targeting hair follicle cycling, collagen synthesis, and keratin production.

#### KLOW - BPC-157 | TB-500 | GHK-Cu | KPV · `AC-KLW`

- URL: https://aminocoreresearch.com/peptides/klow-peptide
- Short URL: https://aminocoreresearch.com/sku/AC-KLW
- SKU: ACR-BL-BTGK
- CAS: 137525-51-0 (BPC-157) · 77591-33-4 (TB-500/Tβ4) · 89030-95-5 (GHK-Cu) · 67247-12-5 (KPV)
- Molecular formula: BPC-157 C₆₂H₉₈N₁₆O₂₂ + TB-500 C₂₁₂H₃₅₀N₅₆O₇₈S + GHK-Cu C₁₄H₂₂CuN₆O₄ + KPV C₁₆H₃₀N₄O₄
- Molecular weight: BPC-157 1,419.53 · TB-500 4,963.44 · GHK-Cu 403.9 (Cu complex) · KPV 342.44 g/mol
- Sequence: BPC-157: GEPPPGKPADDAGLV | TB-500 (Tβ4): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | GHK-Cu: Gly-His-Lys·Cu²⁺ | KPV: Lys-Pro-Val
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Four-peptide research blend combining BPC-157, TB-500, GHK-Cu and KPV — spanning angiogenesis (FAK-paxillin, VEGF), actin remodeling, copper-dependent matrix signaling, and melanocortin/NF-κB-mediated immune modulation in a single lyophilized vial.

#### Super Human Blend · `AC-SHU`

- URL: https://aminocoreresearch.com/peptides/super-human-blend
- Short URL: https://aminocoreresearch.com/sku/AC-SHU
- SKU: ACR-BL-SH
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Comprehensive multi-peptide research blend combining tissue repair, neuroprotection, immune modulation, and GH axis compounds. Broad-spectrum regeneration research stack.

#### WOLVERINE - BPC-157 | TB-500 · `AC-WLV`

- URL: https://aminocoreresearch.com/peptides/wolverine-bpc-157-tb-500
- Short URL: https://aminocoreresearch.com/sku/AC-WLV
- SKU: ACR-WOLV
- CAS: BPC-157: 137525-51-0; TB-500: 77591-33-4
- Molecular formula: Blend (BPC-157: C62H98N16O22 + TB-500: C212H350N56O78S)
- Molecular weight: BPC-157: 1419.53 g/mol; TB-500: 4963.44 g/mol
- Sequence: BPC-157: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val | TB-500 (Thymosin Beta-4 fragment): Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Dual-peptide research blend pairing BPC-157 (5mg) and TB-500 (5mg) — the so-called "Wolverine" combination — for complementary tissue repair, angiogenesis, and cytoskeletal remodeling investigations. Each peptide targets distinct but synergistic regenerative pathways.

#### WOLVERINE Capsules - BPC-157 | TB-500

- URL: https://aminocoreresearch.com/peptides/wolverine-capsules
- SKU: ACR-WOLV-C30
- Purity: ≥99%
- Form: Capsule
- Storage: Store sealed at room temperature, away from light and humidity

Oral capsule presentation of the WOLVERINE blend (BPC-157 and TB-500) at 500 mcg total peptide per capsule, 30 capsules per bottle.


### Cognitive & Neuroprotection

#### B7-33 (Relaxin-3 Receptor Agonist)

- URL: https://aminocoreresearch.com/peptides/b7-33-relaxin-3-receptor-agonist
- SKU: AC-B733
- CAS: 1923828-60-9
- Molecular formula: C₁₃₇H₂₁₁N₄₁O₄₂S₄
- Molecular weight: 3198.72 g/mol
- Sequence: Arg-Trp-Ser-Ser-Trp-Gly-Pro-Gly-Pro-Ala-Ala-Asn-Val-Arg-Val-Ala-Ser-Ile-Leu-Arg-Asn-Ala-Lys-His-Ala-Val-Val
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Selective RXFP1 receptor agonist based on the relaxin-3 B-chain. Researched for anxiolytic effects, cardiovascular protection, and metabolic regulation.

#### Cortagen

- URL: https://aminocoreresearch.com/peptides/cortagen
- SKU: CORT-001
- CAS: 152796-48-4
- Molecular formula: C17H26N4O9
- Molecular weight: 430.41 g/mol
- Sequence: Ala-Glu-Asp-Pro (AEDP)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Cortex-derived bioregulatory tetrapeptide (Ala-Glu-Asp-Pro). Researched for neuroprotective effects and brain cortex function normalization in aging models.

#### Dihexa

- URL: https://aminocoreresearch.com/peptides/dihexa
- SKU: ACR-DIHEXA-C60
- CAS: 1401708-83-5
- Molecular formula: C25H33N3O4
- Molecular weight: 439.55 g/mol
- Sequence: N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide (small molecule, not a peptide chain)
- Purity: ≥99%
- Form: Capsule
- Storage: Store sealed at room temperature, away from light and humidity

Dihexa (PNB-0408) is an angiotensin IV analog studied as a small-molecule modulator of hepatocyte growth factor (HGF) and its receptor c-Met. A 439.55 g/mol compound investigated in neurotrophic and synaptogenesis research.

#### DSIP

- URL: https://aminocoreresearch.com/peptides/dsip
- SKU: ACR-DSIP
- CAS: 62568-57-4
- Molecular formula: C35H48N10O15
- Molecular weight: 848.81 g/mol
- Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Delta Sleep-Inducing Peptide. A nonapeptide originally isolated from cerebral venous blood, studied in neuroscience research.

#### P21 (ACI-35)

- URL: https://aminocoreresearch.com/peptides/p21
- SKU: P21-001
- CAS: 1334156-79-8
- Molecular formula: C78H113N17O19S
- Molecular weight: 1640.91 g/mol
- Sequence: Ac-DGGLAG-NH2 (acetylated N-terminus, amidated C-terminus; derived from CNTF residues 146-151 — the core sequence under investigation is the hexapeptide DGGLAG, also reported as the related sequence MDGGLAG depending on source)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

CNTF (Ciliary Neurotrophic Factor)-derived peptide researched for promoting neurogenesis in the hippocampus. Studied for cognitive enhancement and neurodegenerative disease models.

#### PE-22-28

- URL: https://aminocoreresearch.com/peptides/pe-22-28
- SKU: PE22-001
- CAS: 1233882-22-8
- Molecular formula: C₃₅H₅₇N₁₁O₉
- Molecular weight: 779.89 g/mol
- Sequence: H-Ala-Cys-Glu-Pro-Trp-Glu-Pro-NH2 (with modifications, 7 amino acids derived from spadin)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Synthetic spadin analog targeting the TREK-1 potassium channel. Researched for antidepressant-like properties and rapid-onset neurological effects in preclinical models.

#### Pinealon

- URL: https://aminocoreresearch.com/peptides/pinealon
- SKU: PIN-001
- CAS: 863966-20-5
- Molecular formula: C15H26N6O8
- Molecular weight: 418.40 g/mol
- Sequence: Glu-Asp-Arg (EDR)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Short bioregulatory tripeptide (Glu-Asp-Arg) from the Khavinson peptide family. Researched for neuroprotective effects, CNS regulation, and pineal gland function.

#### Selank

- URL: https://aminocoreresearch.com/peptides/selank
- SKU: ACR-SELANK
- CAS: 129954-34-3
- Molecular formula: C33H57N11O9
- Molecular weight: 751.90 g/mol
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TP-7, tuftsin analog with added Pro-Gly-Pro C-terminal extension)
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Selank (TP-7) is a synthetic heptapeptide analog of the endogenous immunomodulatory peptide tuftsin (Thr-Lys-Pro-Arg), extended with a Pro-Gly-Pro tripeptide to enhance metabolic stability. Extensively studied for its interactions with GABAergic neurotransmission, monoamine modulation, and anxiolytic-like activity in preclinical and clinical models without benzodiazepine-like sedation.

#### Semax

- URL: https://aminocoreresearch.com/peptides/semax
- SKU: ACR-SEMAX
- CAS: 80714-61-0
- Molecular formula: C37H51N9O10S
- Molecular weight: 813.93 g/mol
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
- Purity: ≥99%
- Form: Lyophilized Powder
- Storage: Store at -20°C

Synthetic heptapeptide derived from the ACTH(4-10) fragment. Investigated for its interaction with neurotrophic factor expression pathways.


### Accessories

#### 0.5ml Syringe with Cap, 31G 1/4-inch (6mm), Individually Packaged — 30-Pack

- URL: https://aminocoreresearch.com/peptides/0-5ml-syringe-with-cap-31g-1-4-inch-6mm-individually-packaged-30-pack
- SKU: ACR-SYR-
- Form: Lyophilized Powder
- Storage: Store at -20°C

Sterile, individually blistered 0.5 mL insulin-style syringes with permanently attached 31G 1/4-inch (6 mm) thin-wall needles and protective tip caps. Supplied as a 30-pack for single-use peptide reconstitution and low-volume aliquoting in laboratory research workflows.

#### Acetic Acid (Reconstitution Solvent)

- URL: https://aminocoreresearch.com/peptides/acetic-acid
- SKU: ACR-ACET
- Purity: USP Grade
- Form: Sterile Solution
- Storage: Store at room temperature, protected from light

Dilute acetic acid solution for reconstituting hydrophobic research peptides that resist dissolution in aqueous solvents. Used as a co-solvent alongside bacteriostatic water. Supplied sterile-filtered in a sealed vial. Research use only — not for human or veterinary use.

#### Bacteriostatic Water

- URL: https://aminocoreresearch.com/peptides/bacteriostatic-water
- SKU: ACR-BAC
- CAS: 7732-18-5 (water); 100-51-6 (benzyl alcohol)
- Molecular formula: H2O (with 0.9% C6H5CH2OH benzyl alcohol)
- Molecular weight: 18.015 g/mol (water); 108.14 g/mol (benzyl alcohol)
- Sequence: N/A — small-molecule diluent
- Purity: USP Grade
- Form: Lyophilized Powder
- Storage: Store at -20°C

Sterile, non-pyrogenic water containing 0.9% (9 mg/mL) benzyl alcohol as a bacteriostatic preservative. Used as a diluent for the reconstitution of lyophilized peptides and other research compounds, supporting multi-dose vial use for up to 28 days when stored under proper conditions.

#### DMSO (Anhydrous Dimethyl Sulfoxide)

- URL: https://aminocoreresearch.com/peptides/dmso
- SKU: ACR-DMSO
- CAS: 67-68-5
- Molecular formula: C2H6OS
- Molecular weight: 78.13 g/mol
- Purity: ≥99.9% (anhydrous)
- Form: Anhydrous Liquid
- Storage: Store at room temperature, sealed and protected from moisture and light

Anhydrous dimethyl sulfoxide for preparing stock solutions of research compounds that are poorly soluble in water or dilute acid — including SLU-PP-332, which standard laboratory practice dissolves in DMSO at 10–50 mM. Aprotic solvent, CAS 67-68-5. Research use only — not for human or veterinary use.

#### Lipo-B Injection

- URL: https://aminocoreresearch.com/peptides/lipo-b
- SKU: ACR-LIPOB
- Sequence: Multi-component lipotropic blend
- Form: Solution
- Storage: Store at 2-8°C. Protect from light.

Lipotropic B-complex blend containing methionine, inositol, choline, and B-vitamins for metabolic pathway research.

#### Lipo-C Injection

- URL: https://aminocoreresearch.com/peptides/lipo-c
- SKU: ACR-LIPOC
- Sequence: Multi-component lipotropic + carnitine blend
- Form: Solution
- Storage: Store at 2-8°C. Protect from light.

Enhanced lipotropic complex with L-carnitine. Contains methionine, inositol, choline, B-vitamins, and L-carnitine for research.

#### Small Research Kit - Syringes, prep pads and Bac Water

- URL: https://aminocoreresearch.com/peptides/small-research-kit-syringes-prep-pads-and-bac-water
- SKU: ACR-SMKT
- CAS: N/A (Kit - multiple components)
- Molecular formula: N/A (Kit - multiple components)
- Molecular weight: N/A (Kit - multiple components)
- Sequence: N/A (Kit - multiple components)
- Form: Lyophilized Powder
- Storage: Store at -20°C

Compact research kit with syringes, alcohol prep pads, and Bacteriostatic Water. Essential supplies for peptide reconstitution protocols.


---

## Research Articles (excerpts, top 40 by readership)

### Livagen (Lys-Glu-Asp-Ala): Chromatin Activation in Lymphocytes

- URL: https://aminocoreresearch.com/articles/livagen-peptide-research
- Author: AminoCore Research Team
- Reading time: 7 min
- Published: 2026-08-06
- Topics: livagen,bioregulator,khavinson,Lys-Glu-Asp-Ala,KEDA,chromatin,lymphocytes,hepatic

Livagen is one of the few bioregulators whose published work tests the family mechanism directly — chromatin activation in lymphocytes from older donors, using human cells rather than a phenotype proxy.

### What Does "For Research Use Only" Mean? RUO Explained Clearly

- URL: https://aminocoreresearch.com/articles/what-does-for-research-use-only-mean
- Author: Amino Core Research
- Reading time: 8 min
- Published: 2025-01-18
- Topics: Research Peptides, RUO, Research Use Only, FDA Regulations, Peptide Compliance, Laboratory Research

A clear scientific explanation of what "For Research Use Only" (RUO) means, including FDA guidance, legal implications, and how RUO labeling applies to research peptides.

### SLU-PP-915: Orally Active ERR Pan-Agonist and Exercise Mimetic

- URL: https://aminocoreresearch.com/articles/slu-pp-915-err-agonist-exercise-mimetic
- Author: AminoCore Research
- Reading time: 20 min
- Published: 2026-03-09
- Topics: SLU-PP-915, ERR Agonist, Exercise Mimetic, Mitochondrial Biogenesis, Heart Failure, Metabolic Syndrome, Nuclear Receptor, Skeletal Muscle

A comprehensive scientific overview of SLU-PP-915, an orally bioavailable pan-agonist of the estrogen-related receptor (ERR) nuclear receptor family. Covers its chemical design from a boronic acid thiophene scaffold, mechanism of action through ERR-alpha, -beta, and -gamma activation, exercise mimetic properties including enhanced aerobic capacity and Ddit4 induction, cardioprotective effects in pressure-overload heart failure models, metabolic gene regulation, oral pharmacokinetics, synergy with physical exercise, relationship to the SLU-PP-332 predecessor, and the therapeutic potential for obesity, heart failure, sarcopenia, and metabolic disorders.

### GHK-Cu: What It Is, Where It Comes From, and Why Researchers Study It

- URL: https://aminocoreresearch.com/articles/what-is-ghk-cu
- Author: AminoCore Research
- Reading time: 20 min
- Published: 2026-03-04
- Topics: GHK-Cu, Copper Peptides, Peptide Research, Regenerative Peptides, Gene Modulation

A comprehensive, evidence-based guide to GHK-Cu — the naturally occurring copper tripeptide discovered in human plasma. Covering its discovery by Loren Pickart, molecular identity, copper coordination chemistry, gene modulation capacity, preclinical research domains, safety profile, and current limitations in the scientific literature.

### SLU-PP-332: The Science Behind Exercise Mimetics, and Metabolic Reprogramming,  Mitochondrial Medicine

- URL: https://aminocoreresearch.com/articles/slu-pp-332-exercise-mimetic-metabolic-health-mitochondrial-function
- Author: AminoCore Research
- Reading time: 15 min
- Published: 2026-03-01
- Topics: SLU-PP-332,ERR Agonist,Exercise Mimetic,Metabolic Health,Mitochondrial Biogenesis,Fat Oxidation,Small Molecule,Nuclear Receptor,Heart Failure,Muscle Atrophy

A comprehensive, evidence-based guide to SLU-PP-332 — the synthetic ERR agonist redefining exercise mimetic research. Explore its mechanism of action through estrogen-related receptors, preclinical evidence across skeletal muscle, cardiac, hepatic, and renal systems, and peer-reviewed research from ACS Chemical Biology, Circulation, and the Journal of Pharmacology and Experimental Therapeutics.

### GHK-Cu Handling and Storage: Protocols for Research Use

- URL: https://aminocoreresearch.com/articles/ghk-cu-handling-and-storage
- Author: AminoCore Research
- Reading time: 17 min
- Published: 2026-03-04
- Topics: GHK-Cu, Peptide Storage, Reconstitution, Copper Peptide Handling, Laboratory Protocols

Complete handling and storage protocols for GHK-Cu in research settings — covering lyophilized powder storage, reconstitution procedures, visual quality indicators, light and pH sensitivity, storage conditions, aliquoting strategies, degradation prevention, and incompatible substances.

### Peptide Blend Stability: Do Combined Peptides Degrade Faster?

- URL: https://aminocoreresearch.com/articles/peptide-blend-stability
- Author: AminoCore Research
- Reading time: 16 min
- Published: 2026-03-09
- Topics: Peptide Blend Stability, Degradation, Oxidation, Copper, Co-Lyophilization, Storage, Reconstitution, Shelf Life

A detailed scientific analysis of stability considerations specific to multi-peptide blend formulations. Examines whether co-lyophilized peptides degrade faster than individually stored peptides, covering the mechanisms by which shared microenvironments introduce degradation risks not present in single-peptide systems. Discusses copper-mediated oxidation in GHK-Cu-containing blends, pH compromise effects, cross-reactive degradation products, competitive surface adsorption, reconstituted solution stability timelines, and practical storage protocols tailored to blend complexity. Compares stability profiles across Wolverine, GLOW, and KLOW formulations.

### How Long Do Lyophilized Peptides Last? Shelf Life, Storage Conditions, and Real-World Data

- URL: https://aminocoreresearch.com/articles/how-long-do-lyophilized-peptides-last
- Author: AminoCore Research
- Reading time: 12 min
- Published: 2026-03-09
- Topics: Lyophilized Peptides, Shelf Life, Peptide Storage, Stability, Temperature, Residual Moisture, Degradation

An evidence-based guide to the shelf life of lyophilized peptides under various storage conditions. Covers stability timelines at room temperature, 4°C, -20°C, and -80°C, the influence of amino acid composition on longevity, how residual moisture and packaging affect degradation rates, practical indicators of expired peptides, and when to re-test stored material before use in experiments.

### Temperature Effects on Peptides: Thermal Degradation, Cold Chain, and Storage Optimization

- URL: https://aminocoreresearch.com/articles/temperature-effects-on-peptides
- Author: AminoCore Research
- Reading time: 8 min
- Published: 2026-03-09
- Topics: Temperature, Peptide Stability, Arrhenius, Glass Transition, Freeze-Thaw, Cold Chain, Storage, Degradation

A detailed analysis of how temperature affects peptide stability across the entire range from ultra-cold storage through room temperature and elevated thermal stress. Covers Arrhenius kinetics applied to peptide degradation, the critical role of glass transition temperature in lyophilized formulations, freeze-thaw cycle damage mechanisms, cold chain requirements for shipping, frost-free freezer risks, and practical temperature management protocols for research laboratories.

### GHK-Cu Molecular Structure: Copper Coordination and Peptide Chemistry

- URL: https://aminocoreresearch.com/articles/ghk-cu-molecular-structure
- Author: AminoCore Research
- Reading time: 12 min
- Published: 2025-02-01
- Topics: GHK-Cu, Molecular Structure, Copper Coordination, Peptide Chemistry, ATCUN Motif, Spectroscopy

A detailed analysis of GHK-Cu's molecular structure — covering the tripeptide sequence, copper(II) coordination geometry, binary and ternary complex formation, pH-dependent behavior, spectroscopic characterization, structure-activity relationships, and why copper binding is essential for biological function.

### NA-931: Oral Quadruple Receptor Agonist — Complete Research Guide

- URL: https://aminocoreresearch.com/articles/na-931-quadruple-agonist-research
- Author: AminoCore Research
- Reading time: 19 min
- Published: 2026-03-09
- Topics: NA-931, NA-931, GLP-1 Agonist, Quadruple Agonist, Metabolic Research Research, IGF-1, Incretin Therapy, Metabolic Regulation

A science-based overview of NA-931, a first-in-class oral quadruple receptor agonist targeting IGF-1, GLP-1, GIP, and glucagon pathways. Covers the molecular rationale derived from cyclic glycine-proline, the four-receptor mechanism of action, Phase 1 and Phase 2 clinical trial data presented at ADA and EASD 2025, reported safety and tolerability profile, comparison with existing incretin therapies, current limitations of the evidence base, and the outlook for Phase 3 development.

### AOD-9604 FDA GRAS History and Regulatory Status

- URL: https://aminocoreresearch.com/articles/aod-9604-fda-gras-regulatory-history
- Author: AminoCore Research
- Reading time: 15 min
- Published: 2026-03-10
- Topics: AOD-9604, FDA, GRAS, Regulatory, Safety, Clinical Trials, WADA, Research Peptide, Legal Status

A factual analysis of AOD-9604's regulatory history, including its FDA GRAS (Generally Recognized As Safe) designation as a food ingredient, the distinction between GRAS status and drug approval, the clinical trial program that generated the safety data supporting the GRAS determination, the NOAEL findings from toxicology studies, the circumstances of pharmaceutical development termination in 2007, WADA prohibition status for competitive athletes, the current legal classification as a research chemical, and common misconceptions about what FDA GRAS means in practical and regulatory terms.

### MK-677 Research Storage and Stability Protocols: Preserving Oral Bioavailability

- URL: https://aminocoreresearch.com/articles/mk-677-research-storage-stability-protocols-guidelines
- Author: AminoCore Research Team
- Reading time: 8 min
- Published: 2026-04-02
- Topics: MK-677 storage, peptide stability, research protocols, growth hormone secretagogue, laboratory storage

MK-677 (Ibutamoren) maintains its growth hormone secretagogue activity through precise storage protocols that preserve its unique oral bioavailability profile. Critical temperature ranges and environmental controls determine long-term research compound viability.

### Lyophilized Peptides: What Researchers Need to Know

- URL: https://aminocoreresearch.com/articles/lyophilized-peptides-what-researchers-need-to-know
- Author: Amino Core Research
- Reading time: 19 min
- Published: 2025-02-08
- Topics: Lyophilized Peptides, Freeze-Drying, Peptide Storage, Peptide Stability, Reconstitution, Peptide Handling, Laboratory Research, Lyophilization, Peptide Degradation, Quality Control

A comprehensive guide to lyophilized peptides for laboratory researchers — covering the science of freeze-drying, how lyophilization preserves peptide stability, proper storage and handling protocols, reconstitution best practices, degradation pathways to monitor, and evidence-based strategies for maintaining peptide integrity across long-term studies.

### 5-Amino-1MQ Research Guide: NNMT Inhibitor Metabolic Applications

- URL: https://aminocoreresearch.com/articles/5-amino-1mq-research-guide-nnmt-inhibitor-metabolic
- Author: AminoCore Research Team
- Reading time: 8 min
- Published: 2026-03-28
- Topics: metabolic research, NNMT inhibition, NAD+ metabolism, adipose tissue, small molecule inhibitors

5-Amino-1MQ appears to function as a selective NNMT enzyme inhibitor with significant implications for NAD+ metabolism and adipose tissue research applications.

### TB-500 Handling and Storage Guide: Reconstitution, Stability, and Best Practices

- URL: https://aminocoreresearch.com/articles/tb-500-handling-and-storage-guide
- Author: AminoCore Research
- Reading time: 17 min
- Published: 2026-03-04
- Topics: TB-500, Peptide Handling, Peptide Storage, Reconstitution, Lyophilized Peptides, Laboratory Protocols

A practical, evidence-based guide to handling, reconstituting, and storing TB-500 (thymosin beta-4 fragment) for laboratory research. Covering lyophilized powder storage, reconstitution protocols, solvent selection, aliquoting strategies, degradation pathways, quality verification, and common mistakes to avoid.

### AOD-9604 vs hGH Fragment 176-191: Key Differences for Researchers

- URL: https://aminocoreresearch.com/articles/aod-9604-vs-hgh-fragment-176-191
- Author: AminoCore Research
- Reading time: 12 min
- Published: 2026-03-10
- Topics: AOD-9604, hGH Fragment 176-191, Growth Hormone, Peptide Comparison, Tyrosine, Stability, Lipolysis

A scientific comparison of AOD-9604 and hGH Fragment 176-191 — two closely related but distinct peptides derived from the C-terminal region of human growth hormone. Covers the single amino acid difference (N-terminal tyrosine substitution for phenylalanine), how this modification affects stability, lipolytic potency, and research characterization, the shared core sequence and disulfide bond structure, why AOD-9604 was the compound advanced through clinical trials while the unmodified fragment was not, practical implications for research peptide selection, and how to verify identity through analytical methods.

### Peptide Shelf Life After Reconstitution: Timelines, Storage, and Stability Factors

- URL: https://aminocoreresearch.com/articles/peptide-shelf-life-after-reconstitution
- Author: AminoCore Research
- Reading time: 11 min
- Published: 2026-03-09
- Topics: Reconstituted Peptides, Shelf Life, Storage, Aliquoting, Bacteriostatic Water, Degradation, Stability

A practical guide to how long reconstituted peptides remain stable and usable under various storage conditions. Covers stability timelines at room temperature, refrigerated, and frozen storage, the effects of solvent choice and pH on reconstituted stability, sequence-dependent factors that shorten reconstituted shelf life, aliquoting strategies to maximize usable lifetime, signs of degradation in reconstituted solutions, and when to discard reconstituted material.

### Peptide Stability: Complete Research Guide to Shelf Life, Storage, and Degradation

- URL: https://aminocoreresearch.com/articles/peptide-stability-research-guide
- Author: AminoCore Research
- Reading time: 22 min
- Published: 2026-03-18
- Topics: Peptide Stability, Peptide Storage, Degradation, Shelf Life, Lyophilized Peptides, Reconstitution, Oxidation, Deamidation

A comprehensive guide to peptide stability for researchers. Covers chemical and physical degradation pathways including oxidation, deamidation, hydrolysis, and aggregation. Explains how amino acid sequence, temperature, moisture, pH, and light affect shelf life. Provides evidence-based storage protocols for lyophilized and reconstituted peptides, quality verification strategies, and practical approaches to maximizing peptide integrity throughout the research workflow.

### AOD 9604: The Science Behind Targeted Fat Loss, Cartilage Repair, and Metabolic Optimization

- URL: https://aminocoreresearch.com/articles/aod-9604-fat-loss-tissue-repair-metabolic-health
- Author: AminoCore Research
- Reading time: 14 min
- Published: 2025-03-01
- Topics: AOD 9604,Peptide Therapy,Fat Loss,Cartilage Repair,Metabolic Health,Growth Hormone Fragment,Tissue Regeneration,Osteoarthritis

A comprehensive, evidence-based guide to AOD 9604 — the modified growth hormone fragment reshaping peptide therapy. Explore its dual mechanisms in lipolysis and cartilage regeneration, clinical protocols, real-world case studies from Dr. Adam Sewell, M.D., and peer-reviewed research spanning six human clinical trials involving 925 patients.

### GLOW+ Quad-Peptide Blend: BPC-157, GHK-Cu, TB-500 and Thymosin Alpha-1 in Regenerative Research

- URL: https://aminocoreresearch.com/articles/glow-plus-bpc-157-ghk-cu-tb-500-thymosin-alpha-1-regenerative-research
- Author: AminoCore Research Team
- Reading time: 14 min
- Published: 2026-04-16
- Topics: Regenerative Peptide Blends, BPC-157 Research, GHK-Cu Research, TB-500 Research, Thymosin Alpha-1

The GLOW+ quad-peptide blend combines BPC-157, GHK-Cu, TB-500 and Thymosin Alpha-1 across four distinct but converging molecular pathways — tissue repair, extracellular matrix remodeling, actin dynamics and immune modulation — representing one of the most mechanistically comprehensive frameworks in contemporary regenerative peptide research.

### The KLOW Blend: BPC-157, TB-500, GHK-Cu, and KPV Multi-Pathway Research

- URL: https://aminocoreresearch.com/articles/klow-blend-bpc-157-tb-500-ghk-cu-kpv
- Author: AminoCore Research
- Reading time: 17 min
- Published: 2026-03-09
- Topics: KLOW Blend, BPC-157, TB-500, GHK-Cu, KPV, Alpha-MSH, NF-kB, Peptide Blend, Anti-Inflammatory, Tissue Regeneration

A comprehensive scientific analysis of the KLOW blend — a four-peptide co-lyophilized formulation combining GHK-Cu (50 mg), KPV (10 mg), BPC-157 (10 mg), and TB-500 (10 mg) for a total of 80 mg. Covers how KPV extends the GLOW combination by adding dedicated NF-kB-mediated anti-inflammatory modulation, the alpha-MSH-derived tripeptide mechanism of action, PepT1 transporter-mediated intestinal uptake, formulation complexity of four-component systems, stability considerations, quality verification challenges, comparison with simpler blend formulations, and practical guidance for researchers.

### Noopept vs Selank Research Comparison: Cognitive Enhancement Mechanisms

- URL: https://aminocoreresearch.com/articles/noopept-vs-selank-research-comparison-cognitive-mechanisms
- Author: AminoCore Research Team
- Reading time: 8 min
- Published: 2026-04-07
- Topics: nootropic peptides, cognitive enhancement, AMPA receptors, GABA modulation, research protocols

Comparative analysis of Noopept and Selank peptides reveals distinct molecular pathways for cognitive enhancement research. Two compounds targeting different neurochemical systems with measurable research outcomes.

### Solid-Phase Peptide Synthesis (SPPS): The Fmoc Method Explained

- URL: https://aminocoreresearch.com/articles/solid-phase-peptide-synthesis-spps
- Author: AminoCore Research
- Reading time: 18 min
- Published: 2026-03-10
- Topics: SPPS, Fmoc, Solid Phase, Peptide Synthesis, Coupling Reagent, Resin, Deprotection, Piperidine, Manufacturing

A detailed scientific explanation of Fmoc-based solid-phase peptide synthesis (SPPS) — the method used to manufacture virtually all modern research and therapeutic peptides. Covers the historical development from Merrifield's original Boc chemistry to the modern Fmoc/tBu strategy, the chemistry of each step in the synthesis cycle (resin loading, Fmoc deprotection via piperidine-mediated beta-elimination, amino acid activation and coupling, washing), the role of resins and linkers (Wang, Rink amide, 2-chlorotrityl), coupling reagent chemistry (HATU, DIC/OxymaPure, carbodiimides), common side reactions (aspartimide formation, racemization, deletion sequences, aggregation), monitoring methods (…

### Peptide Research Ethics and IRB Guidelines: Institutional Review Protocols

- URL: https://aminocoreresearch.com/articles/peptide-research-ethics-irb-guidelines-institutional-protocols
- Author: AminoCore Research Team
- Reading time: 9 min
- Published: 2026-03-27
- Topics: Research Ethics, IRB Guidelines, Clinical Research, Regulatory Compliance

Institutional Review Board protocols for peptide research require specific ethical frameworks addressing bioactive compounds with complex mechanisms. Understanding IRB submission requirements ensures compliance with federal regulations while protecting research integrity.

### IGF-1 LR3 Research Guide: Insulin-Like Growth Factor Analysis

- URL: https://aminocoreresearch.com/articles/igf-1-lr3-research-guide-insulin-like-growth-factor-analysis
- Author: AminoCore Research Team
- Reading time: 9 min
- Published: 2026-04-04
- Topics: IGF-1 LR3, Growth Factors, Protein Synthesis, Receptor Binding, Research Peptides

Comprehensive analysis of IGF-1 LR3's extended half-life modifications and enhanced receptor binding affinity. Research-grade examination of protein synthesis pathways and molecular mechanisms.

### TB-500: Thymosin Beta-4 Fragment — Mechanisms, Research Evidence, and Clinical Potential

- URL: https://aminocoreresearch.com/articles/what-is-tb-500-thymosin-beta-4
- Author: AminoCore Research
- Reading time: 22 min
- Published: 2026-03-04
- Topics: TB-500, Thymosin Beta-4, Peptide Research, Regenerative Medicine, Tissue Repair

A comprehensive, evidence-based guide to TB-500, the synthetic fragment of thymosin beta-4. Covering its discovery, molecular identity, mechanism of action through G-actin sequestration, key research domains spanning cardiac repair to wound healing, and its emerging clinical potential in regenerative medicine.

### CJC-1295 DAC vs No-DAC Research Comparison: Half-Life and Dosing Protocols

- URL: https://aminocoreresearch.com/articles/cjc-1295-dac-vs-no-dac-research-comparison-protocols
- Author: AminoCore Research Team
- Reading time: 12 min
- Published: 2026-03-26
- Topics: CJC-1295, Growth Hormone Releasing Peptides, Drug Affinity Complex, Peptide Pharmacokinetics, Research Protocols

Research analysis of CJC-1295 with and without Drug Affinity Complex reveals critical differences in plasma half-life duration and dosing frequency protocols for growth hormone releasing peptide studies.

### Evaluating Peptide Blend Quality: Testing, Purity, and Red Flags

- URL: https://aminocoreresearch.com/articles/evaluating-peptide-blend-quality
- Author: AminoCore Research
- Reading time: 16 min
- Published: 2026-03-09
- Topics: Peptide Blend Quality, HPLC, Mass Spectrometry, Certificate of Analysis, Net Peptide Content, Purity, Third-Party Testing

A practical guide for researchers evaluating the quality of peptide blend products. Covers what a credible blend certificate of analysis should contain, how to interpret HPLC data for multi-component systems, mass spectrometry requirements for identity confirmation of each component, the critical role of net peptide content in ratio accuracy, chromatographic resolution challenges for blends with similarly sized peptides, red flags that indicate substandard manufacturing, the case for independent third-party verification, and a systematic quality checklist that researchers can apply to any blend product.

### AOD-9604: Complete Research Guide for Scientists

- URL: https://aminocoreresearch.com/articles/aod-9604-research-guide
- Author: AminoCore Research
- Reading time: 21 min
- Published: 2026-03-10
- Topics: AOD-9604, hGH Fragment, Growth Hormone, Lipolysis, Beta-3 Adrenergic, Obesity, Peptide, GRAS, Cartilage

A comprehensive scientific guide to AOD-9604, the modified C-terminal fragment (amino acids 176-191) of human growth hormone with an N-terminal tyrosine substitution. Covers the discovery at Monash University by Professor Frank Ng, the beta-3 adrenergic receptor mechanism of lipolysis and lipogenesis inhibition, the critical distinction from full hGH (no IGF-1 stimulation, no diabetogenic effects, no GH receptor binding), the complete clinical trial history from Metabolic Pharmaceuticals (six human trials, 900+ subjects), the Phase IIb OPTIONS trial outcome, FDA GRAS status as a food ingredient, emerging cartilage repair and chondroprotective research, WADA prohibition status, practical hand…

### The GLOW Blend: BPC-157, TB-500, and GHK-Cu for Regeneration Research

- URL: https://aminocoreresearch.com/articles/glow-blend-bpc-157-tb-500-ghk-cu
- Author: AminoCore Research
- Reading time: 17 min
- Published: 2026-03-09
- Topics: GLOW Blend, BPC-157, TB-500, GHK-Cu, Copper Peptide, Peptide Blend, Collagen Synthesis, Extracellular Matrix, Tissue Regeneration

A comprehensive scientific analysis of the GLOW blend — a three-peptide co-lyophilized formulation combining BPC-157 (10 mg), TB-500 (10 mg), and GHK-Cu (50 mg). Covers how GHK-Cu extends the Wolverine combination by adding extracellular matrix remodeling and collagen synthesis capabilities, the copper tripeptide mechanism of action, formulation ratios and the significance of the copper ion, stability considerations including metal-catalyzed oxidation risks unique to copper-containing blends, reconstitution protocols, quality verification challenges for three-component systems, and practical guidance for researchers.

### Peptide Lyophilization Process: Research-Grade Freeze Drying Methods

- URL: https://aminocoreresearch.com/articles/peptide-lyophilization-process-research-grade-freeze-drying
- Author: AminoCore Research Team
- Reading time: 9 min
- Published: 2026-03-25
- Topics: Peptide Manufacturing, Lyophilization, Quality Control, Research Methods

Understanding the critical parameters and methodologies behind research-grade peptide lyophilization for optimal stability and reconstitution properties.

### GLP-1 Side Effects: The Science Behind Safety and Tolerance

- URL: https://aminocoreresearch.com/articles/glp-1-side-effects-science
- Author: AminoCore Research
- Reading time: 18 min
- Published: 2026-03-10
- Topics: GLP-1, Side Effects, Safety, Nausea, Pancreatitis, Thyroid, Gallbladder, Tolerability, GLP-1 agonist, GLP dual agonist

A scientific review of the adverse effect profile of GLP-1 receptor agonists. Covers the pharmacological mechanisms behind gastrointestinal side effects (nausea, vomiting, diarrhea, constipation), dose-titration strategies and tachyphylaxis, the pancreatitis question (FAERS signals vs RCT meta-analyses), gallbladder events and cholelithiasis risk from rapid weight loss, thyroid C-cell concerns (rodent data vs human evidence, FDA boxed warning context), perioperative aspiration risk and ASA guidance on gastric retention, muscle mass loss considerations, retinopathy signals, the January 2026 FDA removal of suicidal ideation warning, and how dual agonists like GLP dual agonist peptide may modul…

### BPC-157 Mechanism of Action: NO System, VEGF, and Multi-Pathway Signaling

- URL: https://aminocoreresearch.com/articles/bpc-157-mechanism-of-action
- Author: AminoCore Research
- Reading time: 20 min
- Published: 2026-03-04
- Topics: BPC-157, Mechanism of Action, Nitric Oxide, VEGFR2, Angiogenesis, Signaling Pathways

A detailed molecular analysis of how BPC-157 exerts its biological effects — covering the dual NO-signaling pathways (VEGFR2-Akt-eNOS and Src-Caveolin-1-eNOS), angiogenic mechanisms, growth factor modulation, anti-inflammatory signaling, neurotransmitter interactions, and the cytoprotection framework that unifies these diverse actions.

### The Wolverine Blend: BPC-157 + TB-500 Research Rationale and Practical Guide

- URL: https://aminocoreresearch.com/articles/wolverine-blend-bpc-157-tb-500
- Author: AminoCore Research
- Reading time: 18 min
- Published: 2026-03-09
- Topics: Wolverine Blend, BPC-157, TB-500, Thymosin Beta-4, Peptide Blend, Tissue Repair, Angiogenesis, Cell Migration

A detailed scientific analysis of the Wolverine blend — the combination of BPC-157 and TB-500 (thymosin beta-4 fragment) in a single co-lyophilized formulation. Covers the complementary mechanisms of each peptide, the theoretical rationale for combining them, the preclinical evidence base for each component, formulation details and typical ratios, reconstitution and handling protocols, stability considerations specific to this two-peptide system, quality verification approaches, limitations of the current evidence, and practical guidance for researchers evaluating this combination.

### Sermorelin Research Guide: GHRH Analog Mechanisms and Applications

- URL: https://aminocoreresearch.com/articles/sermorelin-research-guide-ghrh-analog-mechanisms-applications
- Author: AminoCore Research Team
- Reading time: 9 min
- Published: 2026-04-06
- Topics: Growth Hormone Research, GHRH Analogs, Peptide Mechanisms, Research Protocols

Comprehensive analysis of Sermorelin acetate (GHRH 1-29) mechanisms, examining growth hormone-releasing hormone receptor pathways, comparative efficacy versus synthetic GHRPs, and standardized research protocols for laboratory investigations.

### GHK-Cu Mechanism of Action: How a Copper Tripeptide Modulates Biology

- URL: https://aminocoreresearch.com/articles/ghk-cu-mechanism-of-action
- Author: AminoCore Research
- Reading time: 22 min
- Published: 2026-03-04
- Topics: GHK-Cu, Mechanism of Action, Gene Modulation, Copper Peptide, Collagen Synthesis, Matrix Metalloproteinases

An in-depth examination of GHK-Cu's mechanisms of action — from copper coordination and gene modulation to collagen synthesis, MMP regulation, angiogenesis, anti-inflammatory signaling, antioxidant defense, stem cell effects, and copper transport biology.

### Survodutide (BI 456906): GLP-1/Glucagon Dual Agonist Research Overview

- URL: https://aminocoreresearch.com/articles/survodutide-glp1-glucagon-dual-agonist
- Author: AminoCore Research Team
- Reading time: 13 min
- Published: 2026-08-10
- Topics: Incretin Agonists, GLP-1 Research, Glucagon Receptor, MASH Research, Metabolic Peptides

Survodutide (BI 456906) is a dual GLP-1/glucagon receptor co-agonist currently in Phase 3 trials, offering researchers a mechanistic control compound that isolates glucagon receptor contributions to energy expenditure and hepatic lipid metabolism — without the GIP axis present in tirzepatide or retatrutide.

### BPC-157 Molecular Mechanisms: Cytoprotection, Angiogenesis and Nitric Oxide Pathways in Research

- URL: https://aminocoreresearch.com/articles/bpc-157-molecular-mechanisms-cytoprotection-angiogenesis-nitric-oxide-research
- Author: AminoCore Research Team
- Reading time: 14 min
- Published: 2026-06-22
- Topics: BPC-157, nitric oxide pathways, angiogenesis, cytoprotection, VEGF signaling

BPC-157 is a synthetic pentadecapeptide derived from human gastric juice protein whose molecular architecture confers remarkable stability and pleiotropic activity across nitric oxide signaling, VEGF-driven angiogenesis, and FAK-paxillin cytoprotective cascades. This article examines the mechanistic evidence assembled from over three decades of preclinical research.

### Oral vs Injectable GLP-1 Agonists: Formulation Science and Clinical Data

- URL: https://aminocoreresearch.com/articles/oral-vs-injectable-glp-1-agonists
- Author: AminoCore Research
- Reading time: 19 min
- Published: 2026-03-10
- Topics: GLP-1, Oral GLP-1 agonist, Orforglipron, SNAC, Small Molecule, Injectable, Peptide Delivery, Obesity, Formulation

A scientific comparison of oral and injectable GLP-1 receptor agonist formulations. Covers the fundamental barriers to oral peptide delivery, SNAC absorption enhancer technology behind oral GLP-1 agonist peptide (Rybelsus), the bioavailability gap (0.8% oral vs near-complete subcutaneous absorption), dosing restrictions and their pharmacological rationale, high-dose oral GLP-1 agonist peptide (25-50 mg OASIS program), the paradigm shift to non-peptide small-molecule oral GLP-1 agonists (orforglipron Phase 3 ATTAIN data showing 12.4% weight loss at 36 mg), the ATTAIN-Maintain weight maintenance trial, and implications for peptide research and drug delivery.


---

## See Also

- https://aminocoreresearch.com/llms.txt — canonical link index (shorter)
- https://aminocoreresearch.com/sitemap.xml — machine-readable URL list
- https://aminocoreresearch.com/.well-known/ai.txt — per-agent AI permissions
- https://aminocoreresearch.com/articles — full research article library
- https://aminocoreresearch.com/peptides — full product catalog
- https://aminocoreresearch.com/faq — frequently asked questions

## Legal Disclaimer

All products sold by AminoCore Research are intended strictly for in-vitro laboratory research. They are not drugs, supplements, or food products. They are not intended for human or veterinary use, and no claims of therapeutic efficacy are made. Researchers are responsible for compliance with all applicable local, state, and federal regulations.